| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6915 |
Name | TBXA2R |
Synonym | BDPLT13|TXA2-R;thromboxane A2 receptor;TBXA2R;thromboxane A2 receptor |
Definition | prostanoid TP receptor |
Position | 19p13.3 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "An increase in the release of the vasoconstrictor thromboxane A2, suggesting the activation of platelets, occurs in both the primary and secondary forms of pulmonary hypertension. By contrast, the release of prostacyclin is depressed in these patients. Whether the imbalance in the release of these mediators is a cause or a result of pulmonary hypertension is unknown, but it may play a part in the development and maintenance of both forms of the disorder." |
| More detail of all Human literatures about TBXA2R | |
|
Pathways and Diseases |
|
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080 |
Pathway | eicosanoid metabolism;PID BioCarta;100180 |
Pathway | Thromboxane A2 receptor signaling;PID Curated;200069 |
Pathway | Thromboxane signalling through TP receptor;PID Reactome;500293 |
Pathway | Calcium signaling pathway;KEGG PATHWAY;hsa04020 |
Pathway | Prostanoid ligand receptors;PID Reactome;500420 |
Disease | IMMUNE;GAD |
Disease | Asthma;GAD |
Disease | Dermatitis, Atopic;GAD |
Disease | asthma asthma, aspirin-intolerant;GAD |
Disease | Bleeding disorder due to defective thromboxane A2 receptor;OMIM |
|
External Links |
|
Links to Entrez Gene | 6915 |
Links to all GeneRIF Items | 6915 |
Links to iHOP | 6915 |
|
Sequence Information |
|
Nucleotide Sequence |
>6915 : length: 1032 atgtggcccaacggcagttccctggggccctgtttccggcccacaaacattaccctggag gagagacggctgatcgcctcgccctggttcgccgcctccttctgcgtggtgggcctggcc tccaacctgctggccctgagcgtgctggcgggcgcgcggcaggggggttcgcacacgcgc tcctccttcctcaccttcctctgcggcctcgtcctcaccgacttcctggggctgctggtg accggtaccatcgtggtgtcccagcacgccgcgctcttcgagtggcacgccgtggaccct ggctgccgtctctgtcgcttcatgggcgtcgtcatgatcttcttcggcctgtccccgctg ctgctgggggccgccatggcctcagagcgctacctgggtatcacccggcccttctcgcgc ccggcggtcgcctcgcagcgccgcgcctgggccaccgtggggctggtgtgggcggccgcg ctggcgctgggcctgctgcccctgctgggcgtgggtcgctacaccgtgcaatacccgggg tcctggtgcttcctgacgctgggcgccgagtccggggacgtggccttcgggctgctcttc tccatgctgggcggcctctcggtcgggctgtccttcctgctgaacacggtcagcgtggcc accctgtgccacgtctaccacgggcaggaggcggcccagcagcgtccccgggactccgag gtggagatgatggctcagctcctggggatcatggtggtggccagcgtgtgttggctgccc cttctggtcttcatcgcccagacagtgctgcgaaacccgcctgccatgagccccgccggg cagctgtcccgcaccacggagaaggagctgctcatctacttgcgcgtggccacctggaac cagatcctggacccctgggtgtatatcctgttccgccgcgccgtgctccggcgtctccag cctcgcctcagcacccggcccaggtcgctgtccctccagccccagctcacgcagcgctcc gggctgcagtag |
Protein Sequence |
>6915 : length: 343 MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ |