| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7076 |
Name | TIMP1 |
Synonym | CLGI|EPA|EPO|HCI|TIMP;TIMP metallopeptidase inhibitor 1;TIMP1;TIMP metallopeptidase inhibitor 1 |
Definition | TIMP-1|collagenase inhibitor|erythroid potentiating activity|erythroid-potentiating activity|fibroblast collagenase inhibitor|metalloproteinase inhibitor 1|tissue inhibitor of metalloproteinases 1 |
Position | Xp11.3-p11.23 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "In conclusion, BMC transfusion appears to improve survival rate, RVH, and mean RV pressure, and decreases gene expressions of ET-1, ERA, NOS 3, MMP 2, TIMP, IL-6, and TNF-alpha." |
PH | "[Changes of MMP-2,9 and TIMP-1 expressions in rats with pulmonary arterial hypertension after captopril and losartan interventions]." |
| More detail of all Rat literatures about TIMP1 | |
|
Pathways and Diseases |
|
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | inhibition of matrix metalloproteinases;PID BioCarta;100045 |
Pathway | IL6-mediated signaling events;PID Curated;200124 |
Pathway | Hemostasis;Reactome;REACT:604 |
Disease | CANCER;GAD |
Disease | Lupus erythematosus;FunDO |
Disease | Thyroid cancer;FunDO |
Disease | Primary tumor;FunDO |
Disease | Multiple myeloma;FunDO |
Disease | Endometrial Neoplasms;GAD |
Disease | Meningioma;FunDO |
Disease | Lung cancer;FunDO |
Disease | Biliary Atresia;FunDO |
Disease | Melanoma;FunDO |
Disease | Kidney disease;FunDO |
Disease | Breast cancer;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Muscular dystrophy;FunDO |
Disease | Liver cancer;FunDO |
Disease | Parkinson disease;FunDO |
Disease | Aortic aneurysm;FunDO |
Disease | Amyotrophic lateral sclerosis;FunDO |
Disease | Embryoma;FunDO |
Disease | Mucocutaneous lymph node syndrome;FunDO |
Disease | Dermatitis;FunDO |
Disease | Prostate cancer;FunDO |
Disease | IMMUNE;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Subacute sclerosing panencephalitis;FunDO |
Disease | Polycystic ovary syndrome;FunDO |
Disease | Systemic infection;FunDO |
Disease | Dental plaque;FunDO |
Disease | Infiltrating cancer;FunDO |
Disease | Colon cancer;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | Bronchopulmonary dysplasia;FunDO |
Disease | Bronchiolitis obliterans;FunDO |
Disease | Intracranial aneurysm;FunDO |
Disease | Multiple sclerosis;FunDO |
Disease | Glomerulonephritis;FunDO |
Disease | Crohn's disease ulcerative colitis;GAD |
Disease | Liver metastases;FunDO |
Disease | Endometriosis;FunDO |
Disease | Leukemia;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Cervical cancer;FunDO |
Disease | Hypertension;FunDO |
Disease | Heart failure;FunDO |
Disease | Hepatitis B;FunDO |
Disease | Metastasis to lymph nodes;FunDO |
Disease | Enteritis;FunDO |
Disease | Lupus vulgaris;FunDO |
Disease | Azoospermia;FunDO |
Disease | Transient hypertension of pregnancy;FunDO |
Disease | Skin cancer;FunDO |
Disease | Ovary cancer;FunDO |
Disease | Hodgkin's disease;FunDO |
Disease | Asthma;FunDO |
Disease | Atherosclerosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 7076 |
Links to all GeneRIF Items | 7076 |
Links to iHOP | 7076 |
|
Sequence Information |
|
Nucleotide Sequence |
>7076 : length: 624 atggccccctttgagcccctggcttctggcatcctgttgttgctgtggctgatagccccc agcagggcctgcacctgtgtcccaccccacccacagacggccttctgcaattccgacctc gtcatcagggccaagttcgtggggacaccagaagtcaaccagaccaccttataccagcgt tatgagatcaagatgaccaagatgtataaagggttccaagccttaggggatgccgctgac atccggttcgtctacacccccgccatggagagtgtctgcggatacttccacaggtcccac aaccgcagcgaggagtttctcattgctggaaaactgcaggatggactcttgcacatcact acctgcagttttgtggctccctggaacagcctgagcttagctcagcgccggggcttcacc aagacctacactgttggctgtgaggaatgcacagtgtttccctgtttatccatcccctgc aaactgcagagtggcactcattgcttgtggacggaccagctcctccaaggctctgaaaag ggcttccagtcccgtcaccttgcctgcctgcctcgggagccagggctgtgcacctggcag tccctgcggtcccagatagcctga |
Protein Sequence |
>7076 : length: 207 MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR YEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEK GFQSRHLACLPREPGLCTWQSLRSQIA |