| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 7124 |
Name | TNF |
Synonym | DIF|TNF-alpha|TNFA|TNFSF2;tumor necrosis factor;TNF;tumor necrosis factor |
Definition | APC1 protein|TNF, macrophage-derived|TNF, monocyte-derived|TNF-a|cachectin|tumor necrosis factor ligand superfamily member 2|tumor necrosis factor-alpha |
Position | 6p21.3 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | TNFalpha can inhibit pulmonary artery smooth muscle cells pyruvate dehydrogenase activity and induce a pulmonary arterial hypertension phenotype. |
PAH | "In conclusion, BMC transfusion appears to improve survival rate, RVH, and mean RV pressure, and decreases gene expressions of ET-1, ERA, NOS 3, MMP 2, TIMP, IL-6, and TNF-alpha." |
PAH | "In conclusion, BMC transfusion appears to improve survival rate, RVH, and mean RV pressure, and decreases gene expressions of ET-1, ERA, NOS 3, MMP 2, TIMP, IL-6, and TNF-alpha." |
| More detail of all Human literatures about TNF | |
Pathways and Diseases | |
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | cadmium induces dna synthesis and proliferation in macrophages;PID BioCarta;100209 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | Alzheimer's disease;KEGG PATHWAY;hsa05010 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | TNF signaling;PID Reactome;500256 |
Pathway | Amoebiasis;KEGG PATHWAY;hsa05146 |
Pathway | TNF receptor signaling pathway;PID Curated;200086 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | Caspase cascade in apoptosis;PID Curated;200148 |
Pathway | NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621 |
Pathway | hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144 |
Pathway | stress induction of hsp regulation;PID BioCarta;100142 |
Pathway | Hematopoietic cell lineage;KEGG PATHWAY;hsa04640 |
Pathway | Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410 |
Pathway | Systemic lupus erythematosus;KEGG PATHWAY;hsa05322 |
Pathway | nf-kb signaling pathway;PID BioCarta;100097 |
Pathway | Hepatitis C;KEGG PATHWAY;hsa05160 |
Pathway | tnfr1 signaling pathway;PID BioCarta;100015 |
Pathway | Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920 |
Pathway | Antigen processing and presentation;KEGG PATHWAY;hsa04612 |
Pathway | Malaria;KEGG PATHWAY;hsa05144 |
Pathway | signal transduction through il1r;PID BioCarta;100132 |
Pathway | visceral fat deposits and the metabolic syndrome;PID BioCarta;100004 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039 |
Pathway | Wnt signaling pathway;PANTHER;P00057 |
Pathway | Downstream signaling in naive CD8+ T cells;PID Curated;200184 |
Pathway | keratinocyte differentiation;PID BioCarta;100119 |
Pathway | ceramide signaling pathway;PID BioCarta;100206 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | Cellular roles of Anthrax toxin;PID Curated;200179 |
Pathway | il-10 anti-inflammatory signaling pathway;PID BioCarta;100134 |
Pathway | HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133 |
Pathway | sodd/tnfr1 signaling pathway;PID BioCarta;100031 |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | nfat and hypertrophy of the heart ;PID BioCarta;100098 |
Pathway | Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664 |
Pathway | Asthma;KEGG PATHWAY;hsa05310 |
Pathway | RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112 |
Pathway | Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620 |
Pathway | Signaling events mediated by HDAC Class I;PID Curated;200070 |
Pathway | IL23-mediated signaling events;PID Curated;200131 |
Pathway | Ceramide signaling pathway;PID Curated;200100 |
Pathway | Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066 |
Pathway | tnf/stress related signaling;PID BioCarta;100026 |
Pathway | Dilated cardiomyopathy;KEGG PATHWAY;hsa05414 |
Pathway | IL27-mediated signaling events;PID Curated;200023 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | Type II diabetes mellitus;KEGG PATHWAY;hsa04930 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | T cell receptor signaling pathway;KEGG PATHWAY;hsa04660 |
Pathway | amb2 Integrin signaling;PID Curated;200108 |
Disease | Granulomatous disease;FunDO |
Disease | inflammatory bowel disease;GAD |
Disease | Sjogren's syndrome;GAD |
Disease | dermatitis herpetiformis.;GAD |
Disease | Septic shock, susceptibility to;OMIM |
Disease | Silicosis;FunDO |
Disease | lep. Leprosy;GAD |
Disease | beta-Thalassemia;GAD |
Disease | Intermediate coronary syndrome;FunDO |
Disease | Psoriasis;FunDO |
Disease | Nasopharyngeal cancer;FunDO |
Disease | Down syndrome;FunDO |
Disease | DEVELOPMENTAL;GAD |
Disease | bronchiectatic disease;GAD |
Disease | longevity;GAD |
Disease | Excessive fat accumulation;GAD |
Disease | Leprosy;FunDO |
Disease | IMMUNE;GAD |
Disease | Multiple myeloma;FunDO |
Disease | meliodosis;GAD |
Disease | COPD;GAD |
Disease | pancreatitis;GAD |
Disease | Polycystic ovary syndrome;FunDO |
Disease | HIV disease;GAD |
Disease | asthma, aspirin-intolerant;GAD |
Disease | Mycoses;FunDO |
Disease | Colon cancer;FunDO |
Disease | Cervical cancer;FunDO |
Disease | hepatitis B;GAD |
Disease | cirrhosis, biliary primary;GAD |
Disease | PSYCH;GAD |
Disease | Obesity ?????????;GAD |
Disease | irritant contact dermatitis;GAD |
Disease | Bone mineral mass;GAD |
Disease | Sarcoidosis;FunDO |
Disease | hematopoietic stem cell transplantation;GAD |
Disease | Basal cell carcinoma;FunDO |
Disease | Renal Cell cancer;FunDO |
Disease | pre-term delivery infant mortality and malaria morbidity;GAD |
Disease | hepatitis, autoimmune;GAD |
Disease | meningococcal disease.;GAD |
Disease | carbamazepine hypersensitivity;GAD |
Disease | synthetic hemodialysis graft failure;GAD |
Disease | Enteritis;FunDO |
Disease | Obesity- associated hypertension ???????;GAD |
Disease | Polyendocrinopathies, Autoimmune;GAD |
Disease | C-reactive protein;GAD |
Disease | brucellosis;GAD |
Disease | Arthritis, Rheumatoid;GAD |
Disease | Infertility;FunDO |
Disease | multiple sclerosis;GAD |
Disease | malarial anemia and cerebral malaria;GAD |
Disease | Atherosclerosis;FunDO |
Disease | Lupus erythematosus;FunDO |
Disease | Muscular dystrophies;FunDO |
Disease | allergic rhinitis;GAD |
Disease | Subarachnoid Hemorrhage;GAD |
Disease | Carcinoma, Hepatocellular;GAD |
Disease | breast cancer;GAD |
Disease | Alcoholic liver disease;FunDO |
Disease | Graves' disease;GAD |
Disease | Migraine;FunDO |
Disease | Tuberous sclerosis;FunDO |
Disease | recurrent pregnancy loss;GAD |
Disease | ankylosing spondylitis;GAD |
Disease | Liver cancer;FunDO |
Disease | Malignant glioma;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | oral cancer;GAD |
Disease | Mucocutaneous lymph node syndrome;FunDO |
Disease | hypertension;GAD |
Disease | Dermatitis;FunDO |
Disease | Pancreatitis;FunDO |
Disease | coal workers' pneumoconiosis (CWP);GAD |
Disease | systemic inflammatory response syndrome;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | sclerosis, systemic;GAD |
Disease | kidney transplant;GAD |
Disease | silicosis;GAD |
Disease | Histiocytosis;FunDO |
Disease | fibrosing alveolitis;GAD |
Disease | Systemic infection;FunDO |
Disease | Dementia, vascular, susceptibility to;OMIM |
Disease | malaria;GAD |
Disease | Otitis media;FunDO |
Disease | Kidney disease;FunDO |
Disease | emphysema;GAD |
Disease | allograft dysfunction, renal;GAD |
Disease | sepsis;GAD |
Disease | diabetes, type 1;GAD |
Disease | lung function;GAD |
Disease | myasthenia gravis;GAD |
Disease | stroke, hemorrhagic stroke, ischemic;GAD |
Disease | graft-versus-host disease;GAD |
Disease | Kidney Failure, Chronic;GAD |
Disease | AIDS progression;GAD |
Disease | Systemic lupus erythematosus;KEGG DISEASE;H00080 |
Disease | Crohn's disease;GAD |
Disease | Migraine without aura, susceptibility to;OMIM |
Disease | chronic atrophic gastritis and gastric carcinoma;GAD |
Disease | Necrotizing enterocolitis;FunDO |
Disease | increased cardiopulmonary morbidity;GAD |
Disease | Leishmania chagasi infection;GAD |
Disease | Behcet syndrome;FunDO |
Disease | Graft-versus-host disease;KEGG DISEASE;H00084 |
Disease | allograft outcome;GAD |
Disease | chronic GVHD;GAD |
Disease | acute renal allograft rejection;GAD |
Disease | CANCER;GAD |
Disease | schizophrenia;GAD |
Disease | Amyloidosis;FunDO |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | contact hypersensitivity;GAD |
Disease | Migraine Disorders;GAD |
Disease | ulcerative colitis;GAD |
Disease | Arthritis;FunDO |
Disease | mucocutaneous leishmaniasis;GAD |
Disease | Thyroid cancer;FunDO |
Disease | HEMATOLOGICAL;GAD |
Disease | endometriosis;GAD |
Disease | cerebral malaria;GAD |
Disease | Asthma;FunDO |
Disease | Pancreas cancer;FunDO |
Disease | Scarring trachoma;GAD |
Disease | AGING;GAD |
Disease | HIV infection;FunDO |
Disease | cirrhosis;GAD |
Disease | hypothyroidism;GAD |
Disease | Prostate cancer;FunDO |
Disease | Meningococcal Infections;GAD |
Disease | Anemia;FunDO |
Disease | interleukin-1 beta (IL-1 beta) synthesis capacity;GAD |
Disease | rheumatoid arthritis;GAD |
Disease | psoriasis;GAD |
Disease | Leukemia;FunDO |
Disease | Liver Neoplasms;GAD |
Disease | METABOLIC;GAD |
Disease | lupus erythematosus;GAD |
Disease | Schizophrenia;FunDO |
Disease | chronic bronchitis;GAD |
Disease | cirrhosis, alcoholic;GAD |
Disease | tuberculosis;GAD |
Disease | diabetes, type 2;GAD |
Disease | Tuberculosis;FunDO |
Disease | Asthma;KEGG DISEASE;H00079 |
Disease | insulin resistance in obesity;GAD |
Disease | parvovirus B19 infection;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Allograft rejection;KEGG DISEASE;H00083 |
Disease | Lipodystrophy;GAD |
Disease | Bladder cancer;FunDO |
Disease | Melanoma;FunDO |
Disease | myelopathy, HTLV-1 associated;GAD |
Disease | Narcolepsy;FunDO |
Disease | Plasmodium falciparum reinfections;GAD |
Disease | INFECTION;GAD |
Disease | REPRODUCTION;GAD |
Disease | Hepatitis B;FunDO |
Disease | Hypertension/complications*;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Celiac disease;FunDO |
Disease | chronic active hepatitis C infection.;GAD |
Disease | Obesity;FunDO |
Disease | Anorexia nervosa;FunDO |
Disease | increased development of adult T-cell leukemia/lymphoma;GAD |
Disease | chemotherapy-induced pulmonary fibrosis;GAD |
Disease | human narcolepsy.;GAD |
Disease | kidney transplant complications;GAD |
Disease | testicular cancer;GAD |
Disease | stomach cancer;GAD |
Disease | Asthma, susceptibility to;OMIM |
Disease | Thrombophilia;FunDO |
Disease | celiac;GAD |
Disease | Lipodystrophy;FunDO |
Disease | preterm delivery;GAD |
Disease | Alzheimer's disease;GAD |
Disease | kawasaki disease;GAD |
Disease | Periodontitis;FunDO |
Disease | ulcerative colitis and Crohn's disease;GAD |
Disease | migraine;GAD |
Disease | Breast cancer;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Neonatal lupus;NHGRI |
Disease | chronic obstructive pulmonary disease/COPD;GAD |
Disease | Embryoma;FunDO |
Disease | Crohn's disease ulcerative colitis;GAD |
Disease | Fanconi's anemia;FunDO |
Disease | Dementia;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | Pulmonary fibrosis;FunDO |
Disease | head and neck cancer;GAD |
Disease | Aplastic anemia;FunDO |
Disease | Asthma;GAD |
Disease | periodontitis;GAD |
Disease | Helicobacter pylori cagA subtype infection;GAD |
Disease | Stroke;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Nephrosis;FunDO |
Disease | Gastritis;GAD |
Disease | Autoimmune disease;FunDO |
Disease | alcohol abuse;GAD |
Disease | Bone Mineral Density;GAD |
Disease | primary sclerosing cholangitis;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | CHEMDEPENDENCY;GAD |
Disease | Lichen planus;FunDO |
Disease | Crohn's disease inflammatory bowel disease ulcerative colitis;GAD |
Disease | Malaria, cerebral, susceptibility to;OMIM |
Disease | Celiac Disease;GAD |
Disease | Chorioamnionitis;GAD |
Disease | Asthma. Allergy.;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | Familial Mediterranean fever;FunDO |
Disease | Endometriosis;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | thyroid-associated ophthalmopathy;GAD |
Disease | Hypothyroidism;FunDO |
Disease | Heart failure;FunDO |
Disease | Primary Billiary Cirrosis;GAD |
Disease | noncardia gastric cancer;GAD |
Disease | GVHD;GAD |
Disease | Ovary cancer;FunDO |
Disease | limb deficiency anomalies;GAD |
Disease | Malaria;FunDO |
Disease | Lupus;GAD |
Disease | RENAL;GAD |
External Links | |
Links to Entrez Gene | 7124 |
Links to all GeneRIF Items | 7124 |
Links to iHOP | 7124 |
Sequence Information | |
Nucleotide Sequence | >7124 : length: 702 atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag acaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatc gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg gaagagttccccagggacctctctctaatcagccctctggcccaggcagtcagatcatct tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaga gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc aagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgcc gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag accccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttc cagctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgacttt gccgagtctgggcaggtctactttgggatcattgccctgtga |
Protein Sequence | >7124 : length: 233 MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |