| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8742 |
Name | TNFSF12 |
Synonym | APO3L|DR3LG|TWEAK;tumor necrosis factor (ligand) superfamily, member 12;TNFSF12;tumor necrosis factor (ligand) superfamily, member 12 |
Definition | APO3 ligand|APO3/DR3 ligand|TNF-related WEAK inducer of apoptosis|tumor necrosis factor ligand superfamily member 12 |
Position | 17p13 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "Reduced soluble TWEAK was closely correlated to hemodynamic, functional, and serological indices of outcome in patients with pulmonary arterial hypertension." |
| More detail of all Human literatures about TNFSF12 | |
|
Pathways and Diseases |
|
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | induction of apoptosis through dr3 and dr4/5 death receptors;PID BioCarta;100189 |
|
External Links |
|
Links to Entrez Gene | 8742 |
Links to all GeneRIF Items | 8742 |
Links to iHOP | 8742 |
|
Sequence Information |
|
Nucleotide Sequence |
>8742 : length: 750 atggccgcccgtcggagccagaggcggagggggcgccggggggagccgggcaccgccctg ctggtcccgctcgcgctgggcctgggcctggcgctggcctgcctcggcctcctgctggcc gtggtcagtttggggagccgggcatcgctgtccgcccaggagcctgcccaggaggagctg gtggcagaggaggaccaggacccgtcggaactgaatccccagacagaagaaagccaggat cctgcgcctttcctgaaccgactagttcggcctcgcagaagtgcacctaaaggccggaaa acacgggctcgaagagcgatcgcagcccattatgaagttcatccacgacctggacaggac ggagcgcaggcaggtgtggacgggacagtgagtggctgggaggaagccagaatcaacagc tccagccctctgcgctacaaccgccagatcggggagtttatagtcacccgggctgggctc tactacctgtactgtcaggtgcactttgatgaggggaaggctgtctacctgaagctggac ttgctggtggatggtgtgctggccctgcgctgcctggaggaattctcagccactgcggcg agttccctcgggccccagctccgcctctgccaggtgtctgggctgttggccctgcggcca gggtcctccctgcggatccgcaccctcccctgggcccatctcaaggctgcccccttcctc acctacttcggactcttccaggttcactga |
Protein Sequence |
>8742 : length: 249 MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEEL VAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQD GAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLD LLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFL TYFGLFQVH |