| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8743 |
Name | TNFSF10 |
Synonym | APO2L|Apo-2L|CD253|TL2|TRAIL;tumor necrosis factor (ligand) superfamily, member 10;TNFSF10;tumor necrosis factor (ligand) superfamily, member 10 |
Definition | Apo-2 ligand|TNF-related apoptosis inducing ligand TRAIL|chemokine tumor necrosis factor ligand superfamily member 10|tumor necrosis factor (ligand) family, member 10|tumor necrosis factor apoptosis-inducing ligand splice variant delta|tumor necrosis fact |
Position | 3q26 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Data indicate the importance of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) in pulmonary arterial hypertension (PAH) pathogenesis and suggest its potential as a therapeutic target to direct future translational therapies. |
PAH | Data indicate the importance of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) in pulmonary arterial hypertension (PAH) pathogenesis and suggest its potential as a therapeutic target to direct future translational therapies. |
PAH | Data indicate the importance of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) in pulmonary arterial hypertension (PAH) pathogenesis and suggest its potential as a therapeutic target to direct future translational therapies. |
| More detail of all Human literatures about TNFSF10 | |
|
Pathways and Diseases |
|
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | TRAIL signaling;PID Reactome;500257 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | TRAIL signaling pathway;PID Curated;200056 |
Pathway | induction of apoptosis through dr3 and dr4/5 death receptors;PID BioCarta;100189 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Disease | CANCER;GAD |
Disease | Waldenstrom macroglobulinaemia;GAD |
Disease | chronic lymphocytic leukaemia;GAD |
|
External Links |
|
Links to Entrez Gene | 8743 |
Links to all GeneRIF Items | 8743 |
Links to iHOP | 8743 |
|
Sequence Information |
|
Nucleotide Sequence |
>8743 : length: 306 atggctatgatggaggtccaggggggacccagcctgggacagacctgcgtgctgatcgtg atcttcacagtgctcctgcagtctctctgtgtggctgtaacttacgtgtactttaccaac gagctgaagcagatgcaggacaagtactccaaaagtggcattgcttgtttcttaaaagaa gatgacagttattgggaccccaatgacgaagagagtatgaacagcccctgctggcaagtc aagtggcaactccgtcagctcgttagaaagactccaagaatgaaaaggctctgggccgca aaataa |
Protein Sequence |
>8743 : length: 101 MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKE DDSYWDPNDEESMNSPCWQVKWQLRQLVRKTPRMKRLWAAK |