| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 10912 |
Name | GADD45G |
Synonym | CR6|DDIT2|GADD45gamma|GRP17;growth arrest and DNA-damage-inducible, gamma;GADD45G;growth arrest and DNA-damage-inducible, gamma |
Definition | DDIT-2|DNA damage-inducible transcript 2 protein|GADD45-gamma|cytokine-responsive protein CR6|gadd-related protein, 17 kD|growth arrest and DNA damage-inducible protein GADD45 gamma |
Position | 9q22.1-q22.2 |
Gene Type | protein-coding |
TSG scores | Description |
| TUSON ranking | 7503 |
TUSON P-value | 1 |
Pathways and Diseases | |
Pathway | IL12-mediated signaling events;PID Curated;200034 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Disease | Pituitary tumor;FunDO |
Disease | Liver cancer;FunDO |
Disease | protein quantitative trait loci;GAD |
Disease | Protein quantitative trait loci;NHGRI |
External Links | |
Links to Entrez Gene | 10912 |
Links to all GeneRIF Items | 10912 |
Links to iHOP | 10912 |
Sequence Information | The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence | >10912 : length: 480 atgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcag ggtgccgggaaagcgctgcatgagttgctgctgtcggcgcagcgtcagggctgcctcact gccggcgtctacgagtcagccaaagtcttgaacgtggaccccgacaatgtgaccttctgt gtgctggctgcgggtgaggaggacgagggcgacatcgcgctgcagatccattttacgctg atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg ctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatc ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga |
Protein Sequence | >10912 : length: 159 MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC VLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |