General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information |
|
---|---|
Gene ID | 11009 |
Name | IL24 |
Synonym | C49A|FISP|IL10B|MDA7|MOB5|ST16;interleukin 24;IL24;interleukin 24 |
Definition | IL-4-induced secreted protein|interleukin-24|melanocyte-associated Mda-7|melanoma differentiation-associated gene 7 protein|suppression of tumorigenicity 16 (melanoma differentiation) |
Position | 1q32 |
Gene Type | protein-coding |
TSG scores |
Description |
TUSON ranking | 8888 |
TUSON P-value | 1 |
Pathways and Diseases |
|
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | IL23-mediated signaling events;PID Curated;200131 |
Disease | Dermatitis;FunDO |
Disease | palmoplanta pustulosis;GAD |
Disease | Adenovirus infection;FunDO |
Disease | CANCER;GAD |
Disease | Cancer;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Metastatic Melanoma;GAD |
External Links |
|
Links to Entrez Gene | 11009 |
Links to all GeneRIF Items | 11009 |
Links to iHOP | 11009 |
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>11009 : length: 624 atgaattttcaacagaggctgcaaagcctgtggactttagccagcagacccttctgccct cctttgctggcgacagcctctcaaatgcagatggttgtgctcccttgcctgggttttacc ctgcttctctggagccaggtatcaggggcccagggccaagaattccactttgggccctgc caagtgaagggggttgttccccagaaactgtgggaagccttctgggctgtgaaagacact atgcaagctcaggataacatcacgagtgcccggctgctgcagcaggaggttctgcagaac gtctcggatgctgagagctgttaccttgtccacaccctgctggagttctacttgaaaact gttttcaaaaactaccacaatagaacagttgaagtcaggactctgaagtcattctctact ctggccaacaactttgttctcatcgtgtcacaactgcaacccagtcaagaaaatgagatg ttttccatcagagacagtgcacacaggcggtttctgctattccggagagcattcaaacag ttggacgtagaagcagctctgaccaaagcccttggggaagtggacattcttctgacctgg atgcagaaattctacaagctctga |
Protein Sequence |
>11009 : length: 207 MNFQQRLQSLWTLASRPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPC QVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKT VFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQ LDVEAALTKALGEVDILLTWMQKFYKL |