| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 11334 |
Name | TUSC2 |
Synonym | C3orf11|FUS1|PAP|PDAP2;tumor suppressor candidate 2;TUSC2;tumor suppressor candidate 2 |
Definition | PDGFA associated protein 2|PDGFA-associated protein 2|fus-1 protein|fusion 1 protein |
Position | 3p21.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | N/A |
TUSON P-value | N/A |
|
External Links |
|
Links to Entrez Gene | 11334 |
Links to all GeneRIF Items | 11334 |
Links to iHOP | 11334 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>11334 : length: 333 atgggcgccagcgggtccaaagctcggggcctgtggcccttcgcctcggcggccggaggc ggcggctcagaggcagcaggagctgagcaagctttggtgcggcctcggggccgagctgtg ccccccttcgtattcacgcgccgcggctctatgttctatgatgaggatggggatctggct cacgagttctatgaggagacaatcgtcaccaagaacgggcagaagcgggccaagctgagg cgagtgcataagaatctgattcctcagggcatcgtgaagctggatcacccccgcatccac gtggatttccctgtgatcctctatgaggtgtga |
Protein Sequence |
>11334 : length: 110 MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLA HEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV |