| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 134111 |
Name | UBE2QL1 |
Synonym | -;ubiquitin-conjugating enzyme E2Q family-like 1;UBE2QL1;ubiquitin-conjugating enzyme E2Q family-like 1 |
Definition | ubiquitin-conjugating enzyme E2Q-like protein 1 |
Position | 5p15.31 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 17393 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120 |
|
External Links |
|
Links to Entrez Gene | 134111 |
Links to all GeneRIF Items | 134111 |
Links to iHOP | 134111 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>134111 : length: 486 atgaaggagctgcaggacatcgcgcgccttagcgaccgcttcatctccgtggagctggtg gacgagagcctgttcgactggaacgtgaagctgcaccaggtggacaaggactcggtgctg tggcaggacatgaaggagaccaacaccgagttcatcctgctcaacctcaccttccccgac aacttccccttctcgccgcccttcatgcgggtgctcagcccgcgcctggagaacggctac gtgctggacggcggcgccatctgcatggagctgctcacgccgcgcggctggtccagcgcc tacaccgtggaggccgtcatgcgccagttcgcagccagcctggtcaagggccagggacgg atctgtagaaaagctggcaaatcaaaaaagtccttcagtcgcaaggaagctgaagctacc tttaagagtttggtgaagacgcatgaaaaatatggttgggtcaccccgcccgtgtccgac ggctga |
Protein Sequence |
>134111 : length: 161 MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPD NFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGR ICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSDG |