| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1390 |
Name | CREM |
Synonym | CREM-2|ICER|hCREM-2;cAMP responsive element modulator;CREM;cAMP responsive element modulator |
Definition | CREM 2alpha-b protein|CREM 2beta-a protein|cAMP response element modulator|cAMP-responsive element modulator|inducible cAMP early repressor ICER |
Position | 10p11.21 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 5377 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | repression of pain sensation by the transcriptional regulator dream;PID BioCarta;100186 |
Pathway | Transcription regulation by bZIP transcription factor;PANTHER;P00055 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway;PANTHER;P00026 |
Pathway | regulation of spermatogenesis by crem;PID BioCarta;100197 |
Disease | Lupus erythematosus;FunDO |
Disease | Lupus vulgaris;FunDO |
Disease | Panic disorder;FunDO |
Disease | Infertility, Male;FunDO |
|
External Links |
|
Links to Entrez Gene | 1390 |
Links to all GeneRIF Items | 1390 |
Links to iHOP | 1390 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>1390 : length: 414 atgaccatggaaacagttgaatcccagcatgatggaagtataacagcttctttgacagag agcaagtctgctcatgtgcagactcagactggccaaaattcaatccctgctttagctcag gtagcagcaattgcagagacagatgaatctgcagaatcagaaggtgtaattgattctcat aaacgtagagaaatcctttcacgaagaccctcttataggaaaatactgaatgaactgtcc tctgatgtgcctggtgttcccaagattgaagaagagagatcagaggaagaaggaacacca cctagtattgctaccatggcagtaccaactagcatatatcagactagcacggggcaatac agtatgtatgctgcaattcgatatgatacagtgctagctttaagtcttctctag |
Protein Sequence |
>1390 : length: 137 MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSH KRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQY SMYAAIRYDTVLALSLL |