| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1437 |
Name | CSF2 |
Synonym | GMCSF;colony stimulating factor 2 (granulocyte-macrophage);CSF2;colony stimulating factor 2 (granulocyte-macrophage) |
Definition | CSF|granulocyte macrophage-colony stimulating factor|granulocyte-macrophage colony-stimulating factor|molgramostin|sargramostim |
Position | 5q31.1 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 5434 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Regulation of retinoblastoma protein;PID Curated;200191 |
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | Amoebiasis;KEGG PATHWAY;hsa05146 |
Pathway | Calcium signaling in the CD4+ TCR pathway;PID Curated;200159 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | T cell receptor signaling pathway;KEGG PATHWAY;hsa04660 |
Pathway | Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | GMCSF-mediated signaling events;PID Curated;200015 |
Pathway | Hematopoietic cell lineage;KEGG PATHWAY;hsa04640 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Syndecan-2-mediated signaling events;PID Curated;200164 |
Disease | Amyotrophic lateral sclerosis;FunDO |
Disease | atopy;GAD |
Disease | atopic dermatitis.;GAD |
Disease | Dermatitis;FunDO |
Disease | Schistosomiasis;FunDO |
Disease | IMMUNE;GAD |
Disease | Lung cancer;FunDO |
Disease | dermatitis and eczema;GAD |
Disease | Pulmonary alveolar proteinosis;FunDO |
Disease | Asthma;GAD |
Disease | Sickle cell disease;FunDO |
Disease | Lymphoma;FunDO |
Disease | Cervical cancer;FunDO |
Disease | Endometriosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 1437 |
Links to all GeneRIF Items | 1437 |
Links to iHOP | 1437 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>1437 : length: 435 atgtggctgcagagcctgctgctcttgggcactgtggcctgcagcatctctgcacccgcc cgctcgcccagccccagcacgcagccctgggagcatgtgaatgccatccaggaggcccgg cgtctcctgaacctgagtagagacactgctgctgagatgaatgaaacagtagaagtcatc tcagaaatgtttgacctccaggagccgacctgcctacagacccgcctggagctgtacaag cagggcctgcggggcagcctcaccaagctcaagggccccttgaccatgatggccagccac tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttt gaaagtttcaaagagaacctgaaggactttctgcttgtcatcccctttgactgctgggag ccagtccaggagtga |
Protein Sequence |
>1437 : length: 144 MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF ESFKENLKDFLLVIPFDCWEPVQE |