| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1647 |
Name | GADD45A |
Synonym | DDIT1|GADD45;growth arrest and DNA-damage-inducible, alpha;GADD45A;growth arrest and DNA-damage-inducible, alpha |
Definition | DDIT-1|DNA damage-inducible transcript 1 protein|DNA damage-inducible transcript-1|DNA-damage-inducible transcript 1|growth arrest and DNA damage-inducible protein GADD45 alpha|growth arrest and DNA-damage-inducible 45 alpha |
Position | 1p31.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 7501 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | atm signaling pathway;PID BioCarta;100235 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | cell cycle: g2/m checkpoint;PID BioCarta;100159 |
Pathway | hypoxia and p53 in the cardiovascular system;PID BioCarta;100084 |
Pathway | p38 MAPK signaling pathway;PID Curated;200014 |
Pathway | Aurora A signaling;PID Curated;200166 |
Pathway | p53 signaling pathway;PID BioCarta;100083 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | FoxO family signaling;PID Curated;200091 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | PI3 kinase pathway;PANTHER;P00048 |
Disease | Yersinia infection;FunDO |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 1647 |
Links to all GeneRIF Items | 1647 |
Links to iHOP | 1647 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>1647 : length: 396 atgactttggaggaattctcggctggagagcagaagaccgaaagcgaccccgataacgtg gtgttgtgcctgctggcggcggacgaggacgacgacagagatgtggctctgcagatccac ttcaccctgatccaggcgttttgctgcgagaacgacatcaacatcctgcgcgtcagcaac ccgggccggctggcggagctcctgctcttggagaccgacgctggccccgcggcgagcgag ggcgccgagcagcccccggacctgcactgcgtgctggtgacgaatccacattcatctcaa tggaaggatcctgccttaagtcaacttatttgtttttgccgggaaagtcgctacatggat caatgggttccagtgattaatctccctgaacggtga |
Protein Sequence |
>1647 : length: 131 MTLEEFSAGEQKTESDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSN PGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMD QWVPVINLPER |