| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 199 |
Name | AIF1 |
Synonym | AIF-1|IBA1|IRT-1|IRT1;allograft inflammatory factor 1;AIF1;allograft inflammatory factor 1 |
Definition | allograft inflammatory factor-1 splice variant Hara-1|interferon gamma responsive transcript|ionized calcium-binding adapter molecule 1|protein G1 |
Position | 6p21.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 2575 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 199 |
Links to all GeneRIF Items | 199 |
Links to iHOP | 199 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>199 : length: 444 atgagccaaaccagggatttacagggaggaaaagctttcggactgctgaaggcccagcag gaagagaggctggatgagatcaacaagcaattcctagacgatcccaaatatagcagtgat gaggatctgccctccaaactggaaggcttcaaagagaaatacatggagtttgaccttaat ggaaatggcgatattgatatcatgtccctgaaacgaatgctggagaaacttggagtcccc aagactcacctagagctaaagaaattaattggagaggtgtccagtggctccggggagacg ttcagctaccctgactttctcaggatgatgctgggcaagagatctgccatcctaaaaatg atcctgatgtatgaggaaaaagcgagagaaaaggaaaagccaacaggccccccagccaag aaagctatctctgagttgccctga |
Protein Sequence |
>199 : length: 147 MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLN GNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKM ILMYEEKAREKEKPTGPPAKKAISELP |