| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 2272 |
Name | FHIT |
Synonym | AP3Aase|FRA3B;fragile histidine triad;FHIT;fragile histidine triad |
Definition | AP3A hydrolase|bis(5'-adenosyl)-triphosphatase|diadenosine 5',5'''-P1,P3-triphosphate hydrolase|dinucleosidetriphosphatase|tumor suppressor protein |
Position | 3p14.2 |
Gene Type | protein-coding |
TSG scores | Description |
| TUSON ranking | 7217 |
TUSON P-value | 1 |
Pathways and Diseases | |
Pathway | Purine metabolism;KEGG PATHWAY;hsa00230 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | Small cell lung cancer;KEGG PATHWAY;hsa05222 |
Disease | ADHD;GAD |
Disease | Epstein-Barr virus infection;FunDO |
Disease | Cancers of the lung and pleura;KEGG DISEASE |
Disease | Gastrointestinal tumor;FunDO |
Disease | Cancer;FunDO |
Disease | Oral cancer;FunDO |
Disease | tumour kinetics and chromosomal instability;GAD |
Disease | cervical cancer;GAD |
Disease | Infection;FunDO |
Disease | prostate cancer;GAD |
Disease | Major depressive disorder;NHGRI |
Disease | Attention deficit hyperactivity disorder;NHGRI |
Disease | PSYCH;GAD |
Disease | Non-small cell lung cancer;KEGG DISEASE;H00014 |
Disease | Penile disease;FunDO |
Disease | CANCER;GAD |
Disease | attention-deficit hyperactivity disorder;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | major depressive disorder;GAD |
Disease | Small cell lung cancer;KEGG DISEASE;H00013 |
Disease | Testicular dysfunction;FunDO |
Disease | Congenital abnormality;FunDO |
Disease | smoking;GAD |
Disease | transcriptional inactivation of the FHIT gene;GAD |
Disease | lung cancer and preneoplastic bronchial lesions;GAD |
External Links | |
Links to Entrez Gene | 2272 |
Links to all GeneRIF Items | 2272 |
Links to iHOP | 2272 |
Sequence Information | The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence | >2272 : length: 444 atgtcgttcagatttggccaacatctcatcaagccctctgtagtgtttctcaaaacagaa ctgtccttcgctcttgtgaataggaaacctgtggtaccaggacatgtccttgtgtgcccg ctgcggccagtggagcgcttccatgacctgcgtcctgatgaagtggccgatttgtttcag acgacccagagagtcgggacagtggtggaaaaacatttccatgggacctctctcaccttt tccatgcaggatggccccgaagccggacagactgtgaagcacgttcacgtccatgttctt cccaggaaggctggagactttcacaggaatgacagcatctatgaggagctccagaaacat gacaaggaggactttcctgcctcttggagatcagaggaggaaatggcagcagaagccgca gctctgcgggtctactttcagtga |
Protein Sequence | >2272 : length: 147 MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH DKEDFPASWRSEEEMAAEAAALRVYFQ |