| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 23612 |
Name | PHLDA3 |
Synonym | TIH1;pleckstrin homology-like domain, family A, member 3;PHLDA3;pleckstrin homology-like domain, family A, member 3 |
Definition | TDAG51/Ipl homolog 1|pleckstrin homology-like domain family A member 3|pleckstrin homology-like domain, family A, member 2 |
Position | 1q31 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 12731 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 23612 |
Links to all GeneRIF Items | 23612 |
Links to iHOP | 23612 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>23612 : length: 384 atgacggcggcggcgacggctaccgtgctcaaggagggcgtgctggagaagcgcagcggc gggctgctgcagctgtggaagcggaagcgctgcgtcctcaccgaacgcgggctgcagctc ttcgaggccaagggcacgggcggccggcccaaggagctcagcttcgcccgcatcaaggcc gtggagtgcgtggagagcaccgggcgccacatctacttcacgctggtgaccgaagggggc ggcgagatcgacttccgctgccccctggaagatcccggctggaacgcccagatcacccta ggcctggtcaagttcaagaaccagcaggccatccagacagtgcgggcccggcagagcctc gggaccgggaccctcgtgtcctaa |
Protein Sequence |
>23612 : length: 127 MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKA VECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSL GTGTLVS |