| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 2950 |
Name | GSTP1 |
Synonym | DFN7|FAEES3|GST3|GSTP|HEL-S-22|PI;glutathione S-transferase pi 1;GSTP1;glutathione S-transferase pi 1 |
Definition | GST class-pi|GSTP1-1|deafness, X-linked 7|epididymis secretory protein Li 22|fatty acid ethyl ester synthase III|glutathione S-transferase P |
Position | 11q13 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 8117 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | multi-drug resistance factors;PID BioCarta;100103 |
Pathway | Metabolism of xenobiotics by cytochrome P450;KEGG PATHWAY;hsa00980 |
Pathway | Biological oxidations;Reactome;REACT:13433 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | Glutathione metabolism;KEGG PATHWAY;hsa00480 |
Pathway | Drug metabolism - cytochrome P450;KEGG PATHWAY;hsa00982 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | glutathione-mediated detoxification;BioCyc;PWY-4061 |
Disease | CANCER;GAD |
Disease | Pre-Eclampsia;FunDO |
Disease | asbestosis or pleural plaques;GAD |
Disease | cytogenetic studies;GAD |
Disease | Silicosis;FunDO |
Disease | chemotherapy-induced leukemia;GAD |
Disease | Asthma;FunDO |
Disease | Cancer;FunDO |
Disease | docetaxel pharmacokinetics docetaxel toxicity;GAD |
Disease | Oral cancer;FunDO |
Disease | Eating disorder;FunDO |
Disease | chronic obstructive pulmonary disease/COPD;GAD |
Disease | DNA adducts;GAD |
Disease | Kuhnt-Junius degeneration;FunDO |
Disease | Amyotrophic lateral sclerosis;FunDO |
Disease | Herpes;FunDO |
Disease | Adenocarcinoma;GAD |
Disease | psychoses;GAD |
Disease | Emphysema;FunDO |
Disease | Prostate cancer;FunDO |
Disease | arsenic toxicity;GAD |
Disease | Cystic fibrosis;FunDO |
Disease | Total IgE. SPT. FEV1;GAD |
Disease | IMMUNE;GAD |
Disease | Parkinson's disease;GAD |
Disease | DNA Damage;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | Aplastic anemia;FunDO |
Disease | Asthma;GAD |
Disease | Hematologic Diseases;GAD |
Disease | 1-hydroxypyrene, urinary;GAD |
Disease | Schizophrenia;FunDO |
Disease | colorectal cancer;GAD |
Disease | Drug abuse;FunDO |
Disease | Primary biliary cirrhosis;FunDO |
Disease | cocaine dependence;GAD |
Disease | esophageal cancer;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | CHEMDEPENDENCY;GAD |
Disease | oral cancer;GAD |
Disease | Psychotic disorder;FunDO |
Disease | Rectal Neoplasms;GAD |
Disease | Testicular dysfunction;FunDO |
Disease | Behcet syndrome;FunDO |
Disease | Deafness;FunDO |
Disease | Kidney failure;FunDO |
Disease | Endometriosis;FunDO |
Disease | METABOLIC;GAD |
Disease | Chronic obstructive airway disease;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | metastatic colorectal cancer;GAD |
Disease | cystic fibrosis.;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | Dermatitis;FunDO |
Disease | methamphetamine abuse;GAD |
Disease | leukemia;GAD |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | Pancreatitis;FunDO |
Disease | breast cancer;GAD |
Disease | Drug-Induced dyskinesia;FunDO |
Disease | stomach cancer;GAD |
Disease | Barrett's esophagus;FunDO |
Disease | Prostate cancer;KEGG DISEASE;H00024 |
Disease | lung cancer;GAD |
Disease | Liver disease;FunDO |
Disease | Peptic esophagitis;FunDO |
|
External Links |
|
Links to Entrez Gene | 2950 |
Links to all GeneRIF Items | 2950 |
Links to iHOP | 2950 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>2950 : length: 633 atgccgccctacaccgtggtctatttcccagttcgaggccgctgcgcggccctgcgcatg ctgctggcagatcagggccagagctggaaggaggaggtggtgaccgtggagacgtggcag gagggctcactcaaagcctcctgcctatacgggcagctccccaagttccaggacggagac ctcaccctgtaccagtccaataccatcctgcgtcacctgggccgcacccttgggctctat gggaaggaccagcaggaggcagccctggtggacatggtgaatgacggcgtggaggacctc cgctgcaaatacatctccctcatctacaccaactatgaggcgggcaaggatgactatgtg aaggcactgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg ctgatccatgaggtcctagcccctggctgcctggatgcgttccccctgctctcagcatat gtggggcgcctcagtgcccggcccaagctcaaggccttcctggcctcccctgagtacgtg aacctccccatcaatggcaacgggaaacagtga |
Protein Sequence |
>2950 : length: 210 MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY VGRLSARPKLKAFLASPEYVNLPINGNGKQ |