| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3065 |
Name | HDAC1 |
Synonym | GON-10|HD1|RPD3|RPD3L1;histone deacetylase 1;HDAC1;histone deacetylase 1 |
Definition | reduced potassium dependency, yeast homolog-like 1 |
Position | 1p34 |
Gene Type | protein-coding |
TSG scores | Description |
| TUSON ranking | 8268 |
TUSON P-value | 1 |
| Caution | This gene might be oncogene according to our integrated oncogene list. |
Pathways and Diseases | |
Pathway | Sumoylation by RanBP2 regulates transcriptional repression;PID Curated;200097 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | multi-step regulation of transcription by pitx2;PID BioCarta;100074 |
Pathway | Retinoic acid receptors-mediated signaling;PID Curated;200142 |
Pathway | Hedgehog signaling events mediated by Gli proteins;PID Curated;200147 |
Pathway | the prc2 complex sets long-term gene silencing through modification of histone tails;PID BioCarta;100063 |
Pathway | role of mef2d in t-cell apoptosis;PID BioCarta;100109 |
Pathway | Huntington's disease;KEGG PATHWAY;hsa05016 |
Pathway | cell cycle: g1/s check point;PID BioCarta;100160 |
Pathway | Presenilin action in Notch and Wnt signaling;PID Curated;200052 |
Pathway | Regulation of Telomerase;PID Curated;200072 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | Regulation of nuclear SMAD2/3 signaling;PID Curated;200002 |
Pathway | Notch-mediated HES/HEY network;PID Curated;200196 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | overview of telomerase protein component gene htert transcriptional regulation;PID BioCarta;100019 |
Pathway | Regulation of retinoblastoma protein;PID Curated;200191 |
Pathway | E2F transcription factor network;PID Curated;200027 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106 |
Pathway | wnt signaling pathway;PID BioCarta;100002 |
Pathway | Regulation of Androgen receptor activity;PID Curated;200102 |
Pathway | Wnt signaling pathway;PANTHER;P00057 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | sumoylation by ranbp2 regulates transcriptional repression;PID BioCarta;100053 |
Pathway | downregulated of mta-3 in er-negative breast tumors;PID BioCarta;100102 |
Pathway | Signaling events mediated by HDAC Class I;PID Curated;200070 |
Pathway | Notch signaling pathway;KEGG PATHWAY;hsa04330 |
Pathway | mechanisms of transcriptional repression by dna methylation;PID BioCarta;100112 |
Pathway | control of gene expression by vitamin d receptor;PID BioCarta;100007 |
Pathway | Notch signaling pathway;PID Curated;200013 |
Pathway | inhibition of huntingtons disease neurodegeneration by histone deacetylase inhibitors;PID BioCarta;100140 |
External Links | |
Links to Entrez Gene | 3065 |
Links to all GeneRIF Items | 3065 |
Links to iHOP | 3065 |
Sequence Information | The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence | >3065 : length: 1449 atggcgcagacgcagggcacccggaggaaagtctgttactactacgacggggatgttgga aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat gctgaggagatgaccaagtaccacagcgatgactacattaaattcttgcgctccatccgt ccagataacatgtcggagtacagcaagcagatgcagagattcaacgttggtgaggactgt ccagtattcgatggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc ctggaactgctaaagtatcaccagagggtgctgtacattgacattgatattcaccatggt gacggcgtggaagaggccttctacaccacggaccgggtcatgactgtgtcctttcataag tatggagagtacttcccaggaactggggacctacgggatatcggggctggcaaaggcaag tattatgctgttaactacccgctccgagacgggattgatgacgagtcctatgaggccatt ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgcggtggtcttacag tgtggctcagactccctatctggggatcggttaggttgcttcaatctaactatcaaagga cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggc ggtggttacaccattcgtaacgttgcccggtgctggacatatgagacagctgtggccctg gatacggagatccctaatgagcttccatacaatgactactttgaatactttggaccagat ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacctggag aagatcaaacagcgactgtttgagaaccttagaatgctgccgcacgcacctggggtccaa atgcaggcgattcctgaggacgccatccctgaggagagtggcgatgaggacgaagacgac cctgacaagcgcatctcgatctgctcctctgacaaacgaattgcctgtgaggaagagttc tccgattctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc aagagagtcaaaacagaggatgaaaaagagaaagacccagaggagaagaaagaagtcacc gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaggaggaggtcaag ttggcctga |
Protein Sequence | >3065 : length: 482 MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK LA |