| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 355 |
Name | FAS |
Synonym | ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6;Fas cell surface death receptor;FAS;Fas cell surface death receptor |
Definition | APO-1 cell surface antigen|CD95 antigen|Delta Fas/APO-1/CD95|FAS 827dupA|FAS receptor variant 9|FASLG receptor|Fas (TNF receptor superfamily, member 6)|Fas AMA|TNF receptor superfamily member 6|apoptosis antigen 1|apoptosis-mediating surface antigen FAS|t |
Position | 10q24.1 |
Gene Type | protein-coding |
TSG scores | Description |
| TUSON ranking | 139 |
TUSON P-value | 0.000115615 |
Pathways and Diseases | |
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | Alzheimer's disease;KEGG PATHWAY;hsa05010 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144 |
Pathway | stress induction of hsp regulation;PID BioCarta;100142 |
Pathway | FAS signaling pathway;PANTHER;P00020 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | fas signaling pathway (cd95);PID BioCarta;100167 |
Pathway | keratinocyte differentiation;PID BioCarta;100119 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | FAS (CD95) signaling pathway;PID Curated;200067 |
Pathway | HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133 |
Pathway | FasL/ CD95L signaling;PID Reactome;500255 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | Autoimmune thyroid disease;KEGG PATHWAY;hsa05320 |
Disease | CANCER;GAD |
Disease | Ischemia;FunDO |
Disease | leukemia, myeloid;GAD |
Disease | Lipodystrophy;FunDO |
Disease | Lupus erythematosus;FunDO |
Disease | Sicca syndrome;FunDO |
Disease | Systemic scleroderma;FunDO |
Disease | Silicosis;FunDO |
Disease | Celiac disease;FunDO |
Disease | Hepatitis C;FunDO |
Disease | Infections caused by retro-transcribing viruses;KEGG DISEASE |
Disease | Hodgkin lymphoma;KEGG DISEASE;H00007 |
Disease | obesity;GAD |
Disease | Respiratory distress syndrome;FunDO |
Disease | bladder cancer;GAD |
Disease | Breast Neoplasms;GAD |
Disease | HIV infection;FunDO |
Disease | Parkinson disease;FunDO |
Disease | hypertension;GAD |
Disease | Chronic simple glaucoma;FunDO |
Disease | Thrombocytopenia;GAD |
Disease | Autoimmune lymphoproliferative syndrome, type IA;OMIM |
Disease | Hydrocephalus;FunDO |
Disease | cervical cancer;GAD |
Disease | HTLV-I infection;FunDO |
Disease | Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE |
Disease | Hyperlipidemias;GAD |
Disease | Pre-Eclampsia;FunDO |
Disease | Pulmonary fibrosis;FunDO |
Disease | HEMATOLOGICAL;GAD |
Disease | head and neck cancer;GAD |
Disease | METABOLIC;GAD |
Disease | Dental plaque;FunDO |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | preterm delivery;GAD |
Disease | Stroke;FunDO |
Disease | Viral infections;KEGG DISEASE |
Disease | systemic lupus erythematosus;GAD |
Disease | Alzheimer's disease;FunDO |
Disease | Liver failure;FunDO |
Disease | Autoimmune disease;FunDO |
Disease | Primary biliary cirrhosis;FunDO |
Disease | cirrhosis, biliary primary;GAD |
Disease | Gastritis;FunDO |
Disease | esophageal cancer;GAD |
Disease | HELLP Syndrome;GAD |
Disease | Thrombocytopenia;FunDO |
Disease | Autoimmune lymphoproliferative syndrome;OMIM |
Disease | Celiac Disease;GAD |
Disease | REPRODUCTION;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Fatty liver;FunDO |
Disease | Chronic lymphocytic leukemia (CLL);KEGG DISEASE;H00005 |
Disease | Lymphopenia;FunDO |
Disease | melanoma;GAD |
Disease | hepatitis type 1, autoimmune (AIH-1);GAD |
Disease | Neoplasms;GAD |
Disease | Neuritis;FunDO |
Disease | Adenovirus infection;FunDO |
Disease | IMMUNE;GAD |
Disease | Growth retardation;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | Squamous cell carcinoma, burn scar-related, somatic;OMIM |
Disease | multiple sclerosis;GAD |
Disease | Cholangitis;FunDO |
Disease | Lupus vulgaris;FunDO |
Disease | Testicular dysfunction;FunDO |
Disease | Obesity;FunDO |
Disease | body mass diabetes, type 2 insulin;GAD |
Disease | Myocardial Infarction;GAD |
Disease | Infertility;FunDO |
Disease | Tumor virus infection;FunDO |
Disease | lung cancer;GAD |
Disease | Cancer;FunDO |
Disease | Adult T-cell leukemia;KEGG DISEASE;H00009 |
Disease | Uveitis;FunDO |
Disease | Esophageal cancer;KEGG DISEASE;H00017 |
Disease | Lupus;GAD |
Disease | Nervous system disease;FunDO |
External Links | |
Links to Entrez Gene | 355 |
Links to all GeneRIF Items | 355 |
Links to iHOP | 355 |
Sequence Information | The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence | >355 : length: 1008 atgctgggcatctggaccctcctacctctggttcttacgtctgttgctagattatcgtcc aaaagtgttaatgcccaagtgactgacatcaactccaagggattggaattgaggaagact gttactacagttgagactcagaacttggaaggcctgcatcatgatggccaattctgccat aagccctgtcctccaggtgaaaggaaagctagggactgcacagtcaatggggatgaacca gactgcgtgccctgccaagaagggaaggagtacacagacaaagcccatttttcttccaaa tgcagaagatgtagattgtgtgatgaaggacatggcttagaagtggaaataaactgcacc cggacccagaataccaagtgcagatgtaaaccaaactttttttgtaactctactgtatgt gaacactgtgacccttgcaccaaatgtgaacatggaatcatcaaggaatgcacactcacc agcaacaccaagtgcaaagaggaaggatccagatctaacttggggtggctttgtcttctt cttttgccaattccactaattgtttgggtgaagagaaaggaagtacagaaaacatgcaga aagcacagaaaggaaaaccaaggttctcatgaatctccaaccttaaatcctgaaacagtg gcaataaatttatctgatgttgacttgagtaaatatatcaccactattgctggagtcatg acactaagtcaagttaaaggctttgttcgaaagaatggtgtcaatgaagccaaaatagat gagatcaagaatgacaatgtccaagacacagcagaacagaaagttcaactgcttcgtaat tggcatcaacttcatggaaagaaagaagcgtatgacacattgattaaagatctcaaaaaa gccaatctttgtactcttgcagagaaaattcagactatcatcctcaaggacattactagt gactcagaaaattcaaacttcagaaatgaaatccaaagcttggtctag |
Protein Sequence | >355 : length: 335 MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV |