| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3605 |
Name | IL17A |
Synonym | CTLA8|IL-17|IL-17A|IL17;interleukin 17A;IL17A;interleukin 17A |
Definition | CTLA-8|cytotoxic T-lymphocyte-associated antigen 8|cytotoxic T-lymphocyte-associated protein 8|interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)|interleukin-17A |
Position | 6p12 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 8851 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Interleukin signaling pathway;PANTHER;P00036 |
Pathway | IL27-mediated signaling events;PID Curated;200023 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | IL23-mediated signaling events;PID Curated;200131 |
Disease | Periodontal disease;FunDO |
Disease | Lupus erythematosus;FunDO |
Disease | Behcet syndrome;FunDO |
Disease | Bone disease;FunDO |
Disease | Bronchiolitis obliterans;FunDO |
Disease | Cystic fibrosis;FunDO |
Disease | Systemic scleroderma;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Multiple sclerosis;FunDO |
Disease | Periodontitis;FunDO |
Disease | Atopic rhinitis;FunDO |
Disease | Asthma;FunDO |
Disease | Arthritis;FunDO |
Disease | Polyarthritis;FunDO |
Disease | Polymyositis;FunDO |
Disease | Uveitis;FunDO |
Disease | Endometriosis;FunDO |
Disease | Histiocytosis;FunDO |
Disease | Immunologic deficiency syndrome;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Sicca syndrome;FunDO |
|
External Links |
|
Links to Entrez Gene | 3605 |
Links to all GeneRIF Items | 3605 |
Links to iHOP | 3605 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>3605 : length: 468 atgactcctgggaagacctcattggtgtcactgctactgctgctgagcctggaggccata gtgaaggcaggaatcacaatcccacgaaatccaggatgcccaaattctgaggacaagaac ttcccccggactgtgatggtcaacctgaacatccataaccggaataccaataccaatccc aaaaggtcctcagattactacaaccgatccacctcaccttggaatctccaccgcaatgag gaccctgagagatatccctctgtgatctgggaggcaaagtgccgccacttgggctgcatc aacgctgatgggaacgtggactaccacatgaactctgtccccatccagcaagagatcctg gtcctgcgcagggagcctccacactgccccaactccttccggctggagaagatactggtg tccgtgggctgcacctgtgtcaccccgattgtccaccatgtggcctaa |
Protein Sequence |
>3605 : length: 155 MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |