| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 400410 |
Name | ST20 |
Synonym | HCCS-1;suppressor of tumorigenicity 20;ST20;suppressor of tumorigenicity 20 |
Definition | cervical cancer suppressor-1|human cervical cancer suppressor gene 1 protein|suppressor of tumorigenicity 20 protein |
Position | 15q25.1 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 15825 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 400410 |
Links to all GeneRIF Items | 400410 |
Links to iHOP | 400410 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>400410 : length: 240 atggcgcgatctcggctcactgcaacctctgtctcccaggttcaggaaaatggctttgta aagaagcttgagcctaaatctggctggatgacttttctagaagttacaggaaagatctgt gaaatgctcttctgtcctgaagcaatactgttgaccagaaaggacactccatattgtgaa accggcctaatttttctgactcttacgaaaacgattgccaacacatacttctacttttaa |
Protein Sequence |
>400410 : length: 79 MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCE TGLIFLTLTKTIANTYFYF |