| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 414899 |
Name | BLID |
Synonym | BRCC2;BH3-like motif containing, cell death inducer;BLID;BH3-like motif containing, cell death inducer |
Definition | BH3-like motif-containing cell death inducer|breast cancer cell 2|breast cancer cell protein 2 |
Position | 11q24.1 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 3490 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 414899 |
Links to all GeneRIF Items | 414899 |
Links to iHOP | 414899 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>414899 : length: 327 atggtgactttgttgcctatagagggccaggaaatacatttctttgagatcctagaatct gagtgtgtgctctacacaggatggatagagcgagcctctggcagttccatttatccagag gcaaaagcacgcctgccactggaggcgctcttgggttccaacaaagaacctatgttgcct aaggaaacagtgctttctcttaaaaggtacaatcttggctcctctgccatgaagcggaat gttcctggacatgtgcttcagagaccttcctatttaaccaggatacaagttacattgtta tgcaattcctctgctgaggccctgtaa |
Protein Sequence |
>414899 : length: 108 MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLP KETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL |