| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 50486 |
Name | G0S2 |
Synonym | -;G0/G1 switch 2;G0S2;G0/G1 switch 2 |
Definition | G0/G1 switch protein 2|G0/G1 switch regulatory protein 2|G0/G1switch 2 |
Position | 1q32.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 7463 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 50486 |
Links to all GeneRIF Items | 50486 |
Links to iHOP | 50486 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>50486 : length: 312 atggaaacggtccaggagctgatccccctggccaaggagatgatggcccagaagcgcaag gggaagatggtgaagctgtacgtgctgggcagcgtgctggccctcttcggcgtggtgctc ggcctgatggagactgtgtgcagccccttcacggccgccagacgtctgcgggaccaggag gcagccgtggcggagctgcaggccgccctggagcgacaggctctccagaagcaagccctg caggagaaaggcaagcagcaggacacggtcctcggcggccgggccctgtccaaccggcag cacgcctcctag |
Protein Sequence |
>50486 : length: 103 METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQE AAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS |