| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 50514 |
Name | DEC1 |
Synonym | CTS9;deleted in esophageal cancer 1;DEC1;deleted in esophageal cancer 1 |
Definition | candidate tumor suppressor CTS9 |
Position | 9q32 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | N/A |
TUSON P-value | N/A |
|
External Links |
|
Links to Entrez Gene | 50514 |
Links to all GeneRIF Items | 50514 |
Links to iHOP | 50514 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>50514 : length: 213 atgacaatgaatgttctggaggctgggaagtggaagagcattgtgccagcacctggtgag ggccttcttgccgtgttacacatgatggtttttactgatgccctgcacagagagaggtct gtaaagtggcaagcaggagtctgctacaatggaggaaaggattttgctgtatctcttgcc aggcccaaggctgcagagggaattgcagattga |
Protein Sequence |
>50514 : length: 70 MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLA RPKAAEGIAD |