| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 51330 |
Name | TNFRSF12A |
Synonym | CD266|FN14|TWEAKR;tumor necrosis factor receptor superfamily, member 12A;TNFRSF12A;tumor necrosis factor receptor superfamily, member 12A |
Definition | FGF-inducible 14|fibroblast growth factor-inducible immediate-early response protein 14|tumor necrosis factor receptor superfamily member 12A|tweak-receptor|type I transmembrane protein Fn14 |
Position | 16p13.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 16843 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
|
External Links |
|
Links to Entrez Gene | 51330 |
Links to all GeneRIF Items | 51330 |
Links to iHOP | 51330 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>51330 : length: 390 atggctcggggctcgctgcgccggttgctgcggctcctcgtgctggggctctggctggcg ttgctgcgctccgtggccggggagcaagcgccaggcaccgccccctgctcccgcggcagc tcctggagcgcggacctggacaagtgcatggactgcgcgtcttgcagggcgcgaccgcac agcgacttctgcctgggctgcgctgcagcacctcctgcccccttccggctgctttggccc atccttgggggcgctctgagcctgaccttcgtgctggggctgctttctggctttttggtc tggagacgatgccgcaggagagagaagttcaccacccccatagaggagaccggcggagag ggctgcccagctgtggcgctgatccagtga |
Protein Sequence |
>51330 : length: 129 MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE GCPAVALIQ |