| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5196 |
Name | PF4 |
Synonym | CXCL4|PF-4|SCYB4;platelet factor 4;PF4;platelet factor 4 |
Definition | C-X-C motif chemokine 4|chemokine (C-X-C motif) ligand 4|iroplact|oncostatin-A |
Position | 4q12-q21 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 12645 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Pathway | CXCR3-mediated signaling events;PID Curated;200150 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
|
External Links |
|
Links to Entrez Gene | 5196 |
Links to all GeneRIF Items | 5196 |
Links to iHOP | 5196 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>5196 : length: 306 atgagctccgcagccgggttctgcgcctcacgccccgggctgctgttcctggggttgctg ctcctgccacttgtggtcgccttcgccagcgctgaagctgaagaagatggggacctgcag tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatggaagg aaaatttgcttggacctgcaagccccgctgtacaagaaaataattaagaaacttttggag agttag |
Protein Sequence |
>5196 : length: 101 MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES |