| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5320 |
Name | PLA2G2A |
Synonym | MOM1|PLA2|PLA2B|PLA2L|PLA2S|PLAS1|sPLA2;phospholipase A2, group IIA (platelets, synovial fluid);PLA2G2A;phospholipase A2, group IIA (platelets, synovial fluid) |
Definition | GIIC sPLA2|NPS-PLA2|group IIA phospholipase A2|non-pancreatic secretory phospholipase A2|phosphatidylcholine 2-acylhydrolase 2A|phospholipase A2, membrane associated |
Position | 1p35 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 12868 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270 |
Pathway | VEGF signaling pathway;KEGG PATHWAY;hsa04370 |
Pathway | Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664 |
Pathway | Pancreatic secretion;KEGG PATHWAY;hsa04972 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | Glypican 1 network;PID Curated;200021 |
Pathway | phospholipases;BioCyc;LIPASYN-PWY |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | Metabolic pathways;KEGG PATHWAY;hsa01100 |
Pathway | Glycerophospholipid metabolism;KEGG PATHWAY;hsa00564 |
Pathway | alpha-Linolenic acid metabolism;KEGG PATHWAY;hsa00592 |
Pathway | Long-term depression;KEGG PATHWAY;hsa04730 |
Pathway | Ether lipid metabolism;KEGG PATHWAY;hsa00565 |
Pathway | Linoleic acid metabolism;KEGG PATHWAY;hsa00591 |
Pathway | GnRH signaling pathway;KEGG PATHWAY;hsa04912 |
Pathway | Arachidonic acid metabolism;KEGG PATHWAY;hsa00590 |
Disease | Drug abuse;FunDO |
Disease | Embryoma;FunDO |
Disease | PSYCH;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | Cystic fibrosis;FunDO |
Disease | Vascular dementia;FunDO |
Disease | Colorectal cancer;OMIM |
Disease | Schizophrenia;FunDO |
Disease | Dental plaque;FunDO |
Disease | Cholelithiasis;FunDO |
Disease | Stroke;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | affective disorder;GAD |
Disease | Neoplasm metastasis;FunDO |
Disease | Atherosclerosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 5320 |
Links to all GeneRIF Items | 5320 |
Links to iHOP | 5320 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>5320 : length: 435 atgaagaccctcctactgttggcagtgatcatgatctttggcctactgcaggcccatggg aatttggtgaatttccacagaatgatcaagttgacgacaggaaaggaagccgcactcagt tatggcttctacggctgccactgtggcgtgggtggcagaggatcccccaaggatgcaacg gatcgctgctgtgtcactcatgactgttgctacaaacgtctggagaaacgtggatgtggc accaaatttctgagctacaagtttagcaactcggggagcagaatcacctgtgcaaaacag gactcctgcagaagtcaactgtgtgagtgtgataaggctgctgccacctgttttgctaga aacaagacgacctacaataaaaagtaccagtactattccaataaacactgcagagggagc acccctcgttgctga |
Protein Sequence |
>5320 : length: 144 MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR NKTTYNKKYQYYSNKHCRGSTPRC |