| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5573 |
Name | PRKAR1A |
Synonym | ACRDYS1|ADOHR|CAR|CNC|CNC1|PKR1|PPNAD1|PRKAR1|TSE1;protein kinase, cAMP-dependent, regulatory, type I, alpha;PRKAR1A;protein kinase, cAMP-dependent, regulatory, type I, alpha |
Definition | Carney complex type 1|cAMP-dependent protein kinase regulatory subunit RIalpha|cAMP-dependent protein kinase type I-alpha regulatory chain|cAMP-dependent protein kinase type I-alpha regulatory subunit|protein kinase A type 1a regulatory subunit|tissue-spe |
Position | 17q24.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 469 |
TUSON P-value | 0.008917886 |
|
Pathways and Diseases |
|
Pathway | transcription regulation by methyltransferase of carm1;PID BioCarta;100220 |
Pathway | Metabotropic glutamate receptor group III pathway;PANTHER;P00039 |
Pathway | Diabetes pathways;Reactome;REACT:15380 |
Pathway | Metabotropic glutamate receptor group I pathway;PANTHER;P00041 |
Pathway | phospholipase c-epsilon pathway;PID BioCarta;100070 |
Pathway | GABA-B receptor II signaling;PANTHER;P05731 |
Pathway | Muscarinic acetylcholine receptor 2 and 4 signaling pathway;PANTHER;P00043 |
Pathway | gata3 participate in activating the th2 cytokine genes expression;PID BioCarta;100157 |
Pathway | Transmembrane transport of small molecules;Reactome;REACT:15518 |
Pathway | Metabotropic glutamate receptor group II pathway;PANTHER;P00040 |
Pathway | attenuation of gpcr signaling;PID BioCarta;100253 |
Pathway | Opioid Signalling;Reactome;REACT:15295 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | Hedgehog signaling pathway;PANTHER;P00025 |
Pathway | Endothelin signaling pathway;PANTHER;P00019 |
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | Insulin signaling pathway;KEGG PATHWAY;hsa04910 |
Pathway | signaling pathway from g-protein families;PID BioCarta;100153 |
Pathway | nitric oxide signaling pathway;PID BioCarta;100092 |
Pathway | activation of csk by camp-dependent protein kinase inhibits signaling through the t cell receptor;PID BioCarta;100196 |
Pathway | how progesterone initiates the oocyte maturation;PID BioCarta;100104 |
Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway;PANTHER;P00026 |
Pathway | transcription factor creb and its extracellular signals;PID BioCarta;100198 |
Pathway | actions of nitric oxide in the heart;PID BioCarta;100094 |
Pathway | stathmin and breast cancer resistance to antimicrotubule agents;PID BioCarta;100027 |
Pathway | Integration of energy metabolism;Reactome;REACT:1505 |
Pathway | Transcription regulation by bZIP transcription factor;PANTHER;P00055 |
Pathway | chrebp regulation by carbohydrates and camp;PID BioCarta;100203 |
Pathway | regulation of bad phosphorylation;PID BioCarta;100233 |
Pathway | activation of camp-dependent protein kinase pka;PID BioCarta;100151 |
Pathway | mcalpain and friends in cell motility;PID BioCarta;100111 |
Pathway | regulation of ck1/cdk5 by type 1 glutamate receptors;PID BioCarta;100201 |
Pathway | repression of pain sensation by the transcriptional regulator dream;PID BioCarta;100186 |
Pathway | cystic fibrosis transmembrane conductance regulator (cftr) and beta 2 adrenergic receptor (b2ar) pathway;PID BioCarta;100205 |
Disease | Adrenocortical tumor, somatic;OMIM |
Disease | Carney complex, type 1;OMIM |
Disease | Pigmented adrenocortical disease, primary, 1;OMIM |
Disease | Thyroid carcinoma, papillary;OMIM |
Disease | Myxoma, intracardiac;OMIM |
|
External Links |
|
Links to Entrez Gene | 5573 |
Links to all GeneRIF Items | 5573 |
Links to iHOP | 5573 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>5573 : length: 1146 atggagtctggcagtaccgccgccagtgaggaggcacgcagccttcgagaatgtgagctc tacgtccagaagcataacattcaagcgctgctcaaagattctattgtgcagttgtgcact gctcgacctgagagacccatggcattcctcagggaatactttgagaggttggagaaggag gaggcaaaacagattcagaatctgcagaaagcaggcactcgtacagactcaagggaggat gagatttctcctcctccacccaacccagtggttaaaggtaggaggcgacgaggtgctatc agcgctgaggtctacacggaggaagatgcggcatcctatgttagaaaggttataccaaaa gattacaagacaatggccgctttagccaaagccattgaaaagaatgtgctgttttcacat cttgatgataatgagagaagtgatatttttgatgccatgttttcggtctcctttatcgca ggagagactgtgattcagcaaggtgatgaaggggataacttctatgtgattgatcaagga gagacggatgtctatgttaacaatgaatgggcaaccagtgttggggaaggagggagcttt ggagaacttgctttgatttatggaacaccgagagcagccactgtcaaagcaaagacaaat gtgaaattgtggggcatcgaccgagacagctatagaagaatcctcatgggaagcacactg agaaagcggaagatgtatgaggaattccttagtaaagtctctattttagagtctctggac aagtgggaacgtcttacggtagctgatgcattggaaccagtgcagtttgaagatgggcag aagattgtggtgcagggagaaccaggggatgagttcttcattattttagaggggtcagct gctgtgctacaacgtcggtcagaaaatgaagagtttgttgaagtgggaagattggggcct tctgattattttggtgaaattgcactactgatgaatcgtcctcgtgctgccacagttgtt gctcgtggccccttgaagtgcgttaagctggaccgacctagatttgaacgtgttcttggc ccatgctcagacatcctcaaacgaaacatccagcagtacaacagttttgtgtcactgtct gtctga |
Protein Sequence |
>5573 : length: 381 MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG PCSDILKRNIQQYNSFVSLSV |