| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 56475 |
Name | RPRM |
Synonym | REPRIMO;reprimo, TP53 dependent G2 arrest mediator candidate;RPRM;reprimo, TP53 dependent G2 arrest mediator candidate |
Definition | candidate mediator of the p53 dependent G2 arrest|candidate mediator of the p53-dependent G2 arrest|protein reprimo|reprimo, TP53 dependant G2 arrest mediator candidate |
Position | 2q23.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 14336 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Disease | Embryoma;FunDO |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 56475 |
Links to all GeneRIF Items | 56475 |
Links to iHOP | 56475 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>56475 : length: 330 atgaatccggccctaggcaaccagacggacgtggcgggcctgttcctggccaacagcagc gaggcgctggagcgagccgtgcgctgctgcacccaggcgtccgtggtgaccgacgacggc ttcgcggagggaggcccggacgagcgtagcctgtacataatgcgcgtggtgcagatcgcg gtcatgtgcgtgctctcactcaccgtggtcttcggcatcttcttcctcggctgcaatctg ctcatcaagtccgagggcatgatcaacttcctcgtgaaggaccggaggccgtctaaggag gtggaggcggtggtcgtggggccctactga |
Protein Sequence |
>56475 : length: 109 MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY |