| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 56616 |
Name | DIABLO |
Synonym | DFNA64|SMAC;diablo, IAP-binding mitochondrial protein;DIABLO;diablo, IAP-binding mitochondrial protein |
Definition | diablo homolog, mitochondrial|direct IAP-binding protein with low pI|second mitochondria-derived activator of caspase |
Position | 12q24.31 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 5953 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | SMAC-mediated apoptotic response;PID Reactome;500268 |
Pathway | p75(NTR)-mediated signaling;PID Curated;200103 |
Pathway | Caspase cascade in apoptosis;PID Curated;200148 |
Pathway | role of mitochondria in apoptotic signaling;PID BioCarta;100106 |
Pathway | SMAC binds to IAPs;PID Reactome;500884 |
Pathway | SMAC-mediated dissociation of IAP:caspase complexes;PID Reactome;500934 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | Release of apoptotic factors from the mitochondria;PID Reactome;500265 |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 56616 |
Links to all GeneRIF Items | 56616 |
Links to iHOP | 56616 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>56616 : length: 720 atggcggctctgaagagttggctgtcgcgcagcgtaacttcattcttcaggtacagacag tgtttgtgtgttcctgttgtggctaactttaagaagcggtgtttctcagaattgataaga ccatggcacaaaactgtgacgattggctttggagtaaccctgtgtgcggttcctattgca cagaaatcagagcctcattcccttagtagtgaagcattgatgaggagagcagtgtctttg gtaacagatagcacctctacctttctctctcagaccacatatgcgttgattgaagctatt actgaatatactaaggctgtttataccttaacttctctttaccgacaatatacaagttta cttgggaaaatgaattcagaggaggaagatgaagtgtggcaggtgatcataggagccaga gctgagatgacttcaaaacaccaagagtacttgaagctggaaaccacttggatgactgca gttggtctttcagagatggcagcagaagctgcatatcaaactggcgcagatcaggcctct ataaccgccaggaatcacattcagctggtgaaactgcaggtggaagaggtgcaccagctc tcccggaaagcagaaaccaagctggcagaagcacagatagaagagctccgtcagaaaaca caggaggaaggggaggagcgggctgagtcggagcaggaggcctacctgcgtgaggattga |
Protein Sequence |
>56616 : length: 239 MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIA QKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSL LGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQAS ITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |