| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 56849 |
Name | TCEAL7 |
Synonym | MPMGp800C04260Q003|WEX5;transcription elongation factor A (SII)-like 7;TCEAL7;transcription elongation factor A (SII)-like 7 |
Definition | TCEA-like protein 7|transcription elongation factor A protein-like 7|transcription elongation factor S-II protein-like 7 |
Position | Xq22.1 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 16260 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 56849 |
Links to all GeneRIF Items | 56849 |
Links to iHOP | 56849 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>56849 : length: 303 atgcaaaaaccctgcaaagaaaacgaaggaaagccaaagtgcagcgtgccaaagagggag gaaaaacgcccgtatggagaatttgaacgccagcaaacagaagggaattttagacagagg ctgcttcagtctctcgaagaatttaaagaggacatagactataggcattttaaagatgaa gaaatgacaagggagggagatgagatggaaaggtgtttggaagagataaggggtctgaga aagaaatttagggctctgcattctaaccataggcattctcgggaccgtccttatcccatt taa |
Protein Sequence |
>56849 : length: 100 MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDE EMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI |