| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 56940 |
Name | DUSP22 |
Synonym | JKAP|JSP-1|JSP1|LMW-DSP2|LMWDSP2|MKP-x|MKPX|VHX;dual specificity phosphatase 22;DUSP22;dual specificity phosphatase 22 |
Definition | JNK-stimulating phosphatase 1|JNK-stimulatory phosphatase-1|MAP kinase phosphatase x|dual specificity protein phosphatase 22|homolog of mouse dual specificity phosphatase LMW-DSP2|low molecular weight dual specificity phosphatase 2|mitogen-activated prote |
Position | 6p25.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 6237 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Oxidative stress response;PANTHER;P00046 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Disease | Breast cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 56940 |
Links to all GeneRIF Items | 56940 |
Links to iHOP | 56940 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>56940 : length: 555 atggggaatgggatgaacaagatcctgcccggcctgtacatcggcaacttcaaagatgcc agagacgcggaacaattgagcaagaacaaggtgacacatattctgtctgtccatgatagt gccaggcctatgttggagggagttaaatacctgtgcatcccagcagcggattcaccatct caaaacctgacaagacatttcaaagaaagtattaaattcattcacgagtgccggctccgc ggtgagagctgccttgtacactgcctggccggggtctccaggagcgtgacactggtgatc gcatacatcatgaccgtcactgactttggctgggaggatgccctgcacaccgtgcgtgct gggagatcctgtgccaaccccaacgtgggcttccagagacagctccaggagtttgagaag catgaggtccatcagtatcggcagtggctgaaggaagaatatggagagagccctttgcag gatgcagaagaagccaaaaacattctggccgctccaggaattctgaagttctgggccttt ctcagaagactgtaa |
Protein Sequence |
>56940 : length: 184 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS QNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA GRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAF LRRL |