| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 56998 |
Name | CTNNBIP1 |
Synonym | ICAT;catenin, beta interacting protein 1;CTNNBIP1;catenin, beta interacting protein 1 |
Definition | beta-catenin-interacting protein 1|beta-catenin-interacting protein ICAT|inhibitor of beta-catenin and Tcf-4 |
Position | 1p36.22 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 5509 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Wnt signaling pathway;KEGG PATHWAY;hsa04310 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106 |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 56998 |
Links to all GeneRIF Items | 56998 |
Links to iHOP | 56998 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>56998 : length: 246 atgaaccgcgagggagctcccgggaagagtccggaggagatgtacattcagcagaaggtc cgagtgctgctcatgctgcggaagatgggatcaaacctgacagccagcgaggaggagttc ctgcgcacctatgcaggggtggtcaacagccagctcagccagctgcctccgcactccatc gaccagggtgcagaggacgtggtgatggcgttttccaggtcggagacggaagaccggagg cagtag |
Protein Sequence |
>56998 : length: 81 MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI DQGAEDVVMAFSRSETEDRRQ |