| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 581 |
Name | BAX |
Synonym | BCL2L4;BCL2-associated X protein;BAX;BCL2-associated X protein |
Definition | BCL2-associated X protein omega|Baxdelta2G9|Baxdelta2G9omega|Baxdelta2omega|apoptosis regulator BAX|bcl-2-like protein 4|bcl2-L-4 |
Position | 19q13.3-q13.4 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 185 |
TUSON P-value | 0.00047345 |
|
Pathways and Diseases |
|
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | Ceramide signaling pathway;PID Curated;200100 |
Pathway | Huntington's disease;KEGG PATHWAY;hsa05016 |
Pathway | Huntington disease;PANTHER;P00029 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | Caspase cascade in apoptosis;PID Curated;200148 |
Pathway | Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014 |
Pathway | Validated targets of C-MYC transcriptional activation;PID Curated;200045 |
Pathway | Colorectal cancer;KEGG PATHWAY;hsa05210 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | Signaling events mediated by HDAC Class III;PID Curated;200020 |
Pathway | hypoxia and p53 in the cardiovascular system;PID BioCarta;100084 |
Pathway | role of mitochondria in apoptotic signaling;PID BioCarta;100106 |
Pathway | regulation of cell cycle progression by plk3;PID BioCarta;100068 |
Pathway | Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141 |
Pathway | apoptotic signaling in response to dna damage;PID BioCarta;100204 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Prion diseases;KEGG PATHWAY;hsa05020 |
Pathway | regulation of bad phosphorylation;PID BioCarta;100233 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | ceramide signaling pathway;PID BioCarta;100206 |
Pathway | Syndecan-2-mediated signaling events;PID Curated;200164 |
Pathway | Activation, translocation and oligomerization of BAX;PID Reactome;501012 |
Disease | Colorectal cancer;KEGG DISEASE;H00020 |
Disease | Epstein-Barr virus infection;FunDO |
Disease | Colorectal cancer;OMIM |
Disease | lymphocytic leukemia;GAD |
Disease | Asthma;FunDO |
Disease | Cancer;FunDO |
Disease | HIV infection;FunDO |
Disease | Glaucoma;FunDO |
Disease | Fanconi's anemia;FunDO |
Disease | Emphysema;FunDO |
Disease | T-cell acute lymphoblastic leukemia;OMIM |
Disease | IMMUNE;GAD |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | Alzheimer's disease;FunDO |
Disease | Autoimmune disease;FunDO |
Disease | Vaccinia;FunDO |
Disease | Adenovirus infection;FunDO |
Disease | CANCER;GAD |
Disease | Graves' disease;FunDO |
Disease | Osteomyelitis;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | Dermatitis;FunDO |
Disease | Abortion;FunDO |
Disease | Gallbladder disease;FunDO |
Disease | Thyroid gland disease;FunDO |
Disease | Osteomyelitis;GAD |
|
External Links |
|
Links to Entrez Gene | 581 |
Links to all GeneRIF Items | 581 |
Links to iHOP | 581 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>581 : length: 657 atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg gtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggaca ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggtgaga ctcctcaagcctcctcacccccaccaccgcgccctcaccaccgcccctgccccaccgtcc ctgccccccgccactcctctgggaccctgggccttctggagcaggtcacagtggtgccct ctccccatcttcagatcatcagatgtggtctataatgcgttttccttacgtgtctga |
Protein Sequence |
>581 : length: 218 MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRLLKPPHPHHRALTTAPAPPS LPPATPLGPWAFWSRSQWCPLPIFRSSDVVYNAFSLRV |