| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5889 |
Name | RAD51C |
Synonym | BROVCA3|FANCO|R51H3|RAD51L2;RAD51 paralog C;RAD51C;RAD51 paralog C |
Definition | DNA repair protein RAD51 homolog 3|RAD51-like protein 2|yeast RAD51 homolog 3 |
Position | 17q22 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 13790 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Homologous recombination;KEGG PATHWAY;hsa03440 |
Disease | Fanconi anemia, complementation group 0;OMIM |
Disease | Breast-ovarian cancer, familial, susceptibility to, 3;OMIM |
|
External Links |
|
Links to Entrez Gene | 5889 |
Links to all GeneRIF Items | 5889 |
Links to iHOP | 5889 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>5889 : length: 408 atgcgcgggaagacgttccgctttgaaatgcagcgggatttggtgagtttcccgctgtct ccagcggtgcgggtgaagctggtgtctgcggggttccagactgctgaggaactcctagag gtgaaaccctccgagcttagcaaagaagttgggatatctaaagcagaagccttagaaact ctgcaaattatcagaagagaatgtctcacaaataaaccaagatatgctggtacatctgag tcacacaagaagtgtacagcactggaacttcttgagcaggagcatacccagggcttcata atcaccttctgttcagcactagatgatattcttgggggtggagtgcccttaatgaaaaca acagaaatttgtggtgcaccaggtgttggaaaaacacaattatggtaa |
Protein Sequence |
>5889 : length: 135 MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALET LQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKT TEICGAPGVGKTQLW |