| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 638 |
Name | BIK |
Synonym | BIP1|BP4|NBK;BCL2-interacting killer (apoptosis-inducing);BIK;BCL2-interacting killer (apoptosis-inducing) |
Definition | apoptosis inducer NBK|apoptosis-inducing NBK|bcl-2-interacting killer |
Position | 22q13.31 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 3482 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | role of mitochondria in apoptotic signaling;PID BioCarta;100106 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Disease | Breast cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 638 |
Links to all GeneRIF Items | 638 |
Links to iHOP | 638 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>638 : length: 483 atgtctgaagtaagacccctctccagagacatcttgatggagaccctcctgtatgagcag ctcctggaacccccgaccatggaggttcttggcatgactgactctgaagaggacctggac cctatggaggacttcgattctttggaatgcatggagggcagtgacgcattggccctgcgg ctggcctgcatcggggacgagatggacgtgagcctcagggccccgcgcctggcccagctc tccgaggtggccatgcacagcctgggtctggctttcatctacgaccagactgaggacatc agggatgttcttagaagtttcatggacggtttcaccacacttaaggagaacataatgagg ttctggagatccccgaaccccgggtcctgggtgtcctgcgaacaggtgctgctggcgctg ctgctgctgctggcgctgctgctgccgctgctcagcgggggcctgcacctgctgctcaag tga |
Protein Sequence |
>638 : length: 160 MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK |