| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7040 |
Name | TGFB1 |
Synonym | CED|DPD1|LAP|TGFB|TGFbeta;transforming growth factor, beta 1;TGFB1;transforming growth factor, beta 1 |
Definition | TGF-beta-1|latency-associated peptide|prepro-transforming growth factor beta-1|transforming growth factor beta-1 |
Position | 19q13.1 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 16396 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Endocytosis;KEGG PATHWAY;hsa04144 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | ALK1 signaling events;PID Curated;200126 |
Pathway | TGF-beta signaling pathway;PANTHER;P00052 |
Pathway | IL12 signaling mediated by STAT4;PID Curated;200197 |
Pathway | cell cycle: g1/s check point;PID BioCarta;100160 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | Pancreatic cancer;KEGG PATHWAY;hsa05212 |
Pathway | Amoebiasis;KEGG PATHWAY;hsa05146 |
Pathway | Regulation of Telomerase;PID Curated;200072 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | IL27-mediated signaling events;PID Curated;200023 |
Pathway | Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410 |
Pathway | Colorectal cancer;KEGG PATHWAY;hsa05210 |
Pathway | Malaria;KEGG PATHWAY;hsa05144 |
Pathway | Influenza Virus Induced Apoptosis;PID Reactome;500929 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Renal cell carcinoma;KEGG PATHWAY;hsa05211 |
Pathway | Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672 |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | Signaling by TGF beta;PID Reactome;500590 |
Pathway | RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112 |
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | Influenza Infection;Reactome;REACT:6167 |
Pathway | Syndecan-1-mediated signaling events;PID Curated;200134 |
Pathway | Dilated cardiomyopathy;KEGG PATHWAY;hsa05414 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | Syndecan-2-mediated signaling events;PID Curated;200164 |
Pathway | Signaling by TGF beta;Reactome;REACT:6844 |
Disease | Glomerulonephritis, IGA;GAD |
Disease | allergic rhinitis;GAD |
Disease | vesicoureteral reflux;GAD |
Disease | Sjogren's syndrome;GAD |
Disease | HEMATOLOGICAL;GAD |
Disease | radiotherapy response;GAD |
Disease | ossification of the posterior longitudinal ligament;GAD |
Disease | proliferative vitreoretinopathy rhegmatogenous retinal detachment;GAD |
Disease | parvovirus B19 infection;GAD |
Disease | cardiovascular;GAD |
Disease | breast cancer;GAD |
Disease | hepatitis B;GAD |
Disease | rheumatic heart disease;GAD |
Disease | nephropathy;GAD |
Disease | radiotherapy;GAD |
Disease | prostatic hyperplasia;GAD |
Disease | hepatitis C;GAD |
Disease | testicular cancer;GAD |
Disease | lung cancer;GAD |
Disease | early onset ischemic heart disease.;GAD |
Disease | IMMUNE;GAD |
Disease | preterm delivery;GAD |
Disease | Giardiasis;GAD |
Disease | duodenal ulcer gastric ulcer;GAD |
Disease | prostate cancer;GAD |
Disease | pancreatitis, chronic;GAD |
Disease | Asthma;GAD |
Disease | blood pressure;GAD |
Disease | periodontitis;GAD |
Disease | prevalent vertebral fractures;GAD |
Disease | Allograft rejection;KEGG DISEASE;H00083 |
Disease | Cystic fibrosis lung disease, modifier of;OMIM |
Disease | INFECTION;GAD |
Disease | Constriction, Pathologic;GAD |
Disease | Bone Mineral Density;GAD |
Disease | METABOLIC;GAD |
Disease | bone density;GAD |
Disease | radiation-induced damage to normal tissues;GAD |
Disease | heart transplant complications;GAD |
Disease | REPRODUCTION;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | cystic fibrosis;GAD |
Disease | CANCER;GAD |
Disease | Myocardial Infarction;GAD |
Disease | HIV Infections;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | VISION;GAD |
Disease | Asthma severity;GAD |
Disease | very low bone mass;GAD |
Disease | atopic dermatitis;GAD |
Disease | Graft-versus-host disease;KEGG DISEASE;H00084 |
Disease | allograft outcome;GAD |
Disease | leukemia;GAD |
Disease | idiopathic pulmonary fibrosis;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Osteoporosis;GAD |
Disease | Camurati-Engelmann disease;OMIM |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | increased incidence of invasive breast cancer;GAD |
Disease | Migraine Disorders;GAD |
Disease | Graft vs Host Disease;GAD |
Disease | Pneumoconiosis;GAD |
Disease | stomach cancer;GAD |
Disease | chronic idiopathic neutropenia;GAD |
Disease | RENAL;GAD |
|
External Links |
|
Links to Entrez Gene | 7040 |
Links to all GeneRIF Items | 7040 |
Links to iHOP | 7040 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>7040 : length: 1173 atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggtg ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctg tacaacagcacccgcgaccgggtggccggggagagtgcagaaccggagcccgagcctgag gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc tatgacaagttcaagcagagtacacacagcatatatatgttcttcaacacatcagagctc cgagaagcggtacctgaacccgtgttgctctcccgggcagagctgcgtctgctgaggctc aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcga tacctcagcaaccggctgctggcacccagcgactcgccagagtggttatcttttgatgtc accggagttgtgcggcagtggttgagccgtggaggggaaattgagggctttcgccttagc gcccactgctcctgtgacagcagggataacacactgcaagtggacatcaacgggttcact accggccgccgaggtgacctggccaccattcatggcatgaaccggcctttcctgcttctc atggccaccccgctggagagggcccagcatctgcaaagctcccggcaccgccgagccctg gacaccaactattgcttcagctccacggagaagaactgctgcgtgcggcagctgtacatt gacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccatgccaac ttctgcctcgggccctgcccctacatttggagcctggacacgcagtacagcaaggtcctg gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcaggcg ctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc aacatgatcgtgcgctcctgcaagtgcagctga |
Protein Sequence |
>7040 : length: 390 MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |