| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7070 |
Name | THY1 |
Synonym | CD90;Thy-1 cell surface antigen;THY1;Thy-1 cell surface antigen |
Definition | CDw90|Thy-1 T-cell antigen|thy-1 antigen|thy-1 membrane glycoprotein |
Position | 11q23.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 16460 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | IL4-mediated signaling events;PID Curated;200018 |
Pathway | Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670 |
Pathway | amb2 Integrin signaling;PID Curated;200108 |
Disease | Cancer;FunDO |
Disease | Immunologic deficiency syndrome;FunDO |
|
External Links |
|
Links to Entrez Gene | 7070 |
Links to all GeneRIF Items | 7070 |
Links to iHOP | 7070 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>7070 : length: 486 atgaacctggccatcagcatcgctctcctgctaacagtcttgcaggtctcccgagggcag aaggtgaccagcctaacggcctgcctagtggaccagagccttcgtctggactgccgccat gagaataccagcagttcacccatccagtacgagttcagcctgacccgtgagacaaagaag cacgtgctctttggcactgtgggggtgcctgagcacacataccgctcccgaaccaacttc accagcaaatacaacatgaaggtcctctacttatccgccttcactagcaaggacgagggc acctacacgtgtgcactccaccactctggccattccccacccatctcctcccagaacgtc acagtgctcagagacaaactggtcaagtgtgagggcatcagcctgctggctcagaacacc tcgtggctgctgctgctcctgctctccctctccctcctccaggccacggatttcatgtcc ctgtga |
Protein Sequence |
>7070 : length: 161 MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKK HVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNV TVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL |