| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7262 |
Name | PHLDA2 |
Synonym | BRW1C|BWR1C|HLDA2|IPL|TSSC3;pleckstrin homology-like domain, family A, member 2;PHLDA2;pleckstrin homology-like domain, family A, member 2 |
Definition | beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein|imprinted in placenta and liver protein|p17-BWR1C|p17-Beckwith-Wiedemann region 1 C|p17-Beckwith-Wiedemann region 1C|pleckstrin homology-like domain family A member 2|tumor suppress |
Position | 11p15.4 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 12730 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 7262 |
Links to all GeneRIF Items | 7262 |
Links to iHOP | 7262 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>7262 : length: 459 atgaaatcccccgacgaggtgctacgcgagggcgagttggagaagcgcagcgacagcctc ttccagctatggaagaagaagcgcggggtgctcacctccgaccgcctgagcctgttcccc gccagcccccgcgcgcgccccaaggagctgcgcttccactccatcctcaaggtggactgc gtggagcgcacgggcaagtacgtgtacttcaccatcgtcaccaccgaccacaaggagatc gacttccgctgcgcgggcgagagctgctggaacgcggccatcgcgctggcgctcatcgat ttccagaaccgccgcgccctgcaggactttcgcagccgccaggaacgcaccgcacccgcc gcacccgccgaggacgccgtggctgccgcggccgccgcaccctccgagccctcggagccc tccaggccatccccgcagcccaaaccccgcacgccatga |
Protein Sequence |
>7262 : length: 152 MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDC VERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPA APAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP |