| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7832 |
Name | BTG2 |
Synonym | PC3|TIS21;BTG family, member 2;BTG2;BTG family, member 2 |
Definition | B-cell translocation gene 2|NGF-inducible anti-proliferative protein PC3|nerve growth factor-inducible anti-proliferative|pheochromacytoma cell-3|protein BTG2 |
Position | 1q32 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 3594 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | btg family proteins and cell cycle regulation;PID BioCarta;100224 |
Pathway | Direct p53 effectors;PID Curated;200101 |
|
External Links |
|
Links to Entrez Gene | 7832 |
Links to all GeneRIF Items | 7832 |
Links to iHOP | 7832 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>7832 : length: 477 atgagccacgggaagggaaccgacatgctcccggagatcgccgccgccgtgggcttcctc tccagcctcctgaggacccggggctgcgtgagcgagcagaggcttaaggtcttcagcggg gcgctccaggaggcactcacagagcactacaaacaccactggtttcccgaaaagccgtcc aagggctccggctaccgctgcattcgcatcaaccacaagatggaccccatcatcagcagg gtggccagccagatcggactcagccagccccagctgcaccagctgctgcccagcgagctg accctgtgggtggacccctatgaggtgtcctaccgcattggggaggacggctccatctgc gtcttgtacgaggaggccccactggccgcctcctgtgggctcctcacctgcaagaaccaa gtgctgctgggccggagcagcccctccaagaactacgtgatggcagtctccagctag |
Protein Sequence |
>7832 : length: 158 MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPS KGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSIC VLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS |