| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 861 |
Name | RUNX1 |
Synonym | AML1|AML1-EVI-1|AMLCR1|CBFA2|EVI-1|PEBP2aB;runt-related transcription factor 1;RUNX1;runt-related transcription factor 1 |
Definition | AML1-EVI-1 fusion protein|CBF-alpha-2|PEA2-alpha B|PEBP2-alpha B|SL3-3 enhancer factor 1 alpha B subunit|SL3/AKV core-binding factor alpha B subunit|acute myeloid leukemia 1 protein|core-binding factor, runt domain, alpha subunit 2|oncogene AML-1|polyomav |
Position | 21q22.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 27 |
TUSON P-value | 1.47E-19 |
| Caution | This gene might be oncogene according to our integrated oncogene list. |
|
Pathways and Diseases |
|
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Acute myeloid leukemia;KEGG PATHWAY;hsa05221 |
Disease | Bone marrow disease;FunDO |
Disease | Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE |
Disease | Vitamin D deficiency;FunDO |
Disease | Platelet disorder, familial, with associated myeloid malignancy;OMIM |
Disease | Chronic myeloid leukemia (CML);KEGG DISEASE;H00004 |
Disease | Leukemia, Myeloid, Acute;GAD |
Disease | Down syndrome;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Osteomyelitis;FunDO |
Disease | IMMUNE;GAD |
Disease | Leukemia, acute myeloid;OMIM |
Disease | Rheumatoid arthritis;FunDO |
Disease | Leukemia;FunDO |
Disease | Asthma;GAD |
Disease | Acute lymphoblastic leukemia (ALL) (Precursor B lymphoblastic leukemia);KEGG DISEASE;H00001 |
Disease | Thrombocytopenia;FunDO |
Disease | CANCER;GAD |
Disease | myeloblastic leukemias;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | Acute myeloid leukemia (AML);KEGG DISEASE;H00003 |
Disease | Ovarian cancer;FunDO |
Disease | Lymphoma;FunDO |
Disease | Hematopoietic system disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 861 |
Links to all GeneRIF Items | 861 |
Links to iHOP | 861 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>861 : length: 1362 atgcgtatccccgtagatgccagcacgagccgccgcttcacgccgccttccaccgcgctg agcccaggcaagatgagcgaggcgttgccgctgggcgccccggacgccggcgctgccctg gccggcaagctgaggagcggcgaccgcagcatggtggaggtgctggccgaccacccgggc gagctggtgcgcaccgacagccccaacttcctctgctccgtgctgcctacgcactggcgc tgcaacaagaccctgcccatcgctttcaaggtggtggccctaggggatgttccagatggc actctggtcactgtgatggctggcaatgatgaaaactactcggctgagctgagaaatgct accgcagccatgaagaaccaggttgcaagatttaatgacctcaggtttgtcggtcgaagt ggaagagggaaaagcttcactctgaccatcactgtcttcacaaacccaccgcaagtcgcc acctaccacagagccatcaaaatcacagtggatgggccccgagaacctcgaagacatcgg cagaaactagatgatcagaccaagcccgggagcttgtccttttccgagcggctcagtgaa ctggagcagctgcggcgcacagccatgagggtcagcccacaccacccagcccccacgccc aaccctcgtgcctccctgaaccactccactgcctttaaccctcagcctcagagtcagatg caggatacaaggcagatccaaccatccccaccgtggtcctacgatcagtcctaccaatac ctgggatccattgcctctccttctgtgcacccagcaacgcccatttcacctggacgtgcc agcggcatgacaaccctctctgcagaactttccagtcgactctcaacggcacccgacctg acagcgttcagcgacccgcgccagttccccgcgctgccctccatctccgacccccgcatg cactatccaggcgccttcacctactccccgacgccggtcacctcgggcatcggcatcggc atgtcggccatgggctcggccacgcgctaccacacctacctgccgccgccctaccccggc tcgtcgcaagcgcagggaggcccgttccaagccagctcgccctcctaccacctgtactac ggcgcctcggccggctcctaccagttctccatggtgggcggcgagcgctcgccgccgcgc atcctgccgccctgcaccaacgcctccaccggctccgcgctgctcaaccccagcctcccg aaccagagcgacgtggtggaggccgagggcagccacagcaactcccccaccaacatggcg ccctccgcgcgcctggaggaggccgtgtggaggccctactga |
Protein Sequence |
>861 : length: 453 MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPG ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM QDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDL TAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPG SSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY |