| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8682 |
Name | PEA15 |
Synonym | HMAT1|HUMMAT1H|MAT1|MAT1H|PEA-15|PED;phosphoprotein enriched in astrocytes 15;PEA15;phosphoprotein enriched in astrocytes 15 |
Definition | 15 kDa phosphoprotein enriched in astrocytes|astrocytic phosphoprotein PEA-15|homolog of mouse MAT-1 oncogene|mammary transforming gene 1, mouse, homolog of|phosphoprotein enriched in diabetes |
Position | 1q21.1 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 12609 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 8682 |
Links to all GeneRIF Items | 8682 |
Links to iHOP | 8682 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>8682 : length: 393 atggctgagtacgggaccctcctgcaagacctgaccaacaacatcacccttgaagatcta gaacagctcaagtcggcctgcaaggaagacatccccagcgaaaagagtgaggagatcact actggcagtgcctggtttagcttcctggagagccacaacaagctggacaaagacaacctc tcctacattgagcacatctttgagatctcccgccgtcctgacctactcactatggtggtt gactacagaacccgtgtgctgaagatctctgaggaggatgagctggacaccaagctaacc cgtatccccagtgccaagaagtacaaagacattatccggcagccctctgaggaagagatc atcaaattggctcccccaccgaagaaggcctga |
Protein Sequence |
>8682 : length: 130 MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNL SYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEI IKLAPPPKKA |