| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 9076 |
Name | CLDN1 |
Synonym | CLD1|ILVASC|SEMP1;claudin 1;CLDN1;claudin 1 |
Definition | claudin-1|senescence-associated epithelial membrane protein 1 |
Position | 3q28-q29 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 5003 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130 |
Pathway | Cell junction organization;Reactome;REACT:20676 |
Pathway | Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514 |
Pathway | Tight junction;KEGG PATHWAY;hsa04530 |
Pathway | Nectin adhesion pathway;PID Curated;200053 |
Pathway | Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670 |
Pathway | Hepatitis C;KEGG PATHWAY;hsa05160 |
Disease | Ichthyosis, leukocyte vacuoles, alopecia, and sclerosing cholangitis;OMIM |
Disease | Infection;FunDO |
Disease | Hematopoietic system disease;FunDO |
Disease | Cancer;FunDO |
Disease | Cholestasis;FunDO |
|
External Links |
|
Links to Entrez Gene | 9076 |
Links to all GeneRIF Items | 9076 |
Links to iHOP | 9076 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>9076 : length: 636 atggccaacgcggggctgcagctgttgggcttcattctcgccttcctgggatggatcggc gccatcgtcagcactgccctgccccagtggaggatttactcctatgccggcgacaacatc gtgaccgcccaggccatgtacgaggggctgtggatgtcctgcgtgtcgcagagcaccggg cagatccagtgcaaagtctttgactccttgctgaatctgagcagcacattgcaagcaacc cgtgccttgatggtggttggcatcctcctgggagtgatagcaatctttgtggccaccgtt ggcatgaagtgtatgaagtgcttggaagacgatgaggtgcagaagatgaggatggctgtc attgggggtgcgatatttcttcttgcaggtctggctattttagttgccacagcatggtat ggcaatagaatcgttcaagaattctatgaccctatgaccccagtcaatgccaggtacgaa tttggtcaggctctcttcactggctgggctgctgcttctctctgccttctgggaggtgcc ctactttgctgttcctgtccccgaaaaacaacctcttacccaacaccaaggccctatcca aaacctgcaccttccagcgggaaagactacgtgtga |
Protein Sequence |
>9076 : length: 211 MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG QIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAV IGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV |