| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 92304 |
Name | SCGB3A1 |
Synonym | HIN-1|HIN1|LU105|PnSP-2|UGRP2;secretoglobin, family 3A, member 1;SCGB3A1;secretoglobin, family 3A, member 1 |
Definition | cytokine HIN-1|cytokine high in normal-1|high in normal 1|pneumo secretory protein 2|secretoglobin family 3A member 1|uteroglobin-related protein 2 |
Position | 5q35.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 14595 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 92304 |
Links to all GeneRIF Items | 92304 |
Links to iHOP | 92304 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>92304 : length: 315 atgaagctcgccgccctcctggggctctgcgtggccctgtcctgcagctccgctgctgct ttcttagtgggctcggccaagcctgtggcccagcctgtcgctgcgctggagtcggcggcg gaggccggggccgggaccctggccaaccccctcggcaccctcaacccgctgaagctcctg ctgagcagcctgggcatccccgtgaaccacctcatagagggctcccagaagtgtgtggct gagctgggtccccaggccgtgggggccgtgaaggccctgaaggccctgctgggggccctg acagtgtttggctga |
Protein Sequence |
>92304 : length: 104 MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLL LSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG |