| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 94241 |
Name | TP53INP1 |
Synonym | SIP|TP53DINP1|TP53INP1A|TP53INP1B|Teap|p53DINP1;tumor protein p53 inducible nuclear protein 1;TP53INP1;tumor protein p53 inducible nuclear protein 1 |
Definition | p53-dependent damage-inducible nuclear protein 1|p53-inducible p53DINP1|stress-induced protein|tumor protein p53-inducible nuclear protein 1 |
Position | 8q22 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 16932 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | Direct p53 effectors;PID Curated;200101 |
Disease | Type 2 diabetes;NHGRI |
|
External Links |
|
Links to Entrez Gene | 94241 |
Links to all GeneRIF Items | 94241 |
Links to iHOP | 94241 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>94241 : length: 495 atgttccagaggctgaataaaatgtttgtgggtgaagtcagttcttcctccaaccaagaa ccagaattcaatgagaaagaagatgatgaatggattcttgttgacttcatagatacttgc actggtttctcagcagaagaagaagaagaagaggaggacatcagtgaagagtcacctact gagcacccttcagtcttttcctgtttaccggcatctcttgagtgcttggctgatacaagt gattcctgctttctccagtttgagtcatgtccaatggaggagagctggtttatcacccca cccccatgttttactgcaggtggattaaccactatcaaggtggaaacaagtcctatggaa aaccttctcattgaacatcccagcatgtctgtctatgctgtgcataactcctgccctggt ctcagtgaggccacccgtgggactgatgaattacatagcccaagtagtcccagggccagg aaaagctgcttataa |
Protein Sequence |
>94241 : length: 164 MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPT EHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPME NLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRARKSCL |