| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 9516 |
Name | LITAF |
Synonym | PIG7|SIMPLE|TP53I7;lipopolysaccharide-induced TNF factor;LITAF;lipopolysaccharide-induced TNF factor |
Definition | LPS-induced TNF-alpha factor|lipopolysaccharide-induced TNF-alpha factor|lipopolysaccharide-induced tumor necrosis factor-alpha factor|p53-induced gene 7 protein|small integral membrane protein of lysosome/late endosome|tumor protein p53 inducible protein |
Position | 16p13.13 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 9907 |
TUSON P-value | 1 |
| Caution | This gene might be oncogene according to our integrated oncogene list. |
|
External Links |
|
Links to Entrez Gene | 9516 |
Links to all GeneRIF Items | 9516 |
Links to iHOP | 9516 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>9516 : length: 486 atgtcggttccaggaccttaccaggcggccactgggccttcctcagcaccatccgcacct ccatcctatgaagagacagtggctgttaacagttattaccccacacctccagctcccatg cctgggccaactacggggcttgtgacggggcctgatgggaagggcatgaatcctccttcg tattatacccagccagcgcccatccccaataacaatccaattaccgtgcagacggtctac gtgcagcaccccatcacctttttggaccgccctatccaaatgtgttgtccttcctgcaac aagatgatcgtgagtcagctgtcctataacgccggtgctctgacctggctgtcctgcggg agcctgtgcctgctggggtgcatagcgggctgctgcttcatccccttctgcgtggatgcc ctgcaggacgtggaccattactgtcccaactgcagagctctcctgggcacctacaagcgt ttgtag |
Protein Sequence |
>9516 : length: 161 MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPS YYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCG SLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL |