|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10077 |
Name | TSPAN32 |
Synonym | ART1|PHEMX|PHMX|TSSC6;tetraspanin 32;TSPAN32;tetraspanin 32 |
Definition | pan-hematopoietic expression protein|protein Phemx|tetraspanin-32|tspan-32|tumor-suppressing STF cDNA 6|tumor-suppressing subchromosomal transferable fragment cDNA 6|tumor-suppressing subtransferable candidate 6 |
Position | 11p15.5 |
Gene Type | protein-coding |
Source | Count: 2; TAG,Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "We previously reported the isolation of a 2.5 Mb tumor-suppressing subchromosomal transferable fragment (STF) from human chromosome 11p15 and the identification of nine known genes and four novel genes within this STF. We now report the isolation of two novel cDNAs, designated here as TSSC4 and TSSC6 (tumor-suppressing STF cDNA 4 and 6), located within the STF." |
| More detail of all 1 literatures about TSPAN32 | |
|
External Links |
|
Links to Entrez Gene | 10077 |
Links to all GeneRIF Items | 10077 |
Links to iHOP | 10077 |
|
Sequence Information |
|
Nucleotide Sequence |
>10077 : length: 963 atggggccttggagtcgagtcagggttgccaaatgccagatgctggtcacctgcttcttt atcttgctgctgggcctctctgtggccaccatggtgactcttacctacttcggggcccac tttgctgtcatccgccgagcgtccctggagaagaacccgtaccaggctgtgcaccaatgg gccttctctgcggggttgagcctggtgggcctcctgactctgggagccgtgctgagcgct gcagccaccgtgagggaggcccagggcctcatggcagggggcttcctgtgcttctccctg gcgttctgcgcacaggtgcaggtggtgttctggagactccacagccccacccaggtggag gacgccatgctggacacctacgacctggtatatgagcaggcgatgaaaggtacgtcccac gtccggcggcaggagctggcggccatccaggacgtgtttctgtgctgtgggaagaagtct cctttcagccgtctggggagcacagaggctgacctgtgtcagggagaggaggcggcgaga gaggactgccttcagggcatccggagcttcctgaggacacaccagcaggtcgcctccagc ctgaccagcatcggcctggccctcacggtgtccgccttgctcttcagctccttcctgtgg tttgccatccgctgtggctgcagcttggaccgcaagggcaaatacaccctgaccccacga gcatgtggccgccagccccaggagcccagcctcttgagatgctcccagggtggacccaca cattgtctccactccgaagcagttgctattggtccaagaggatgctcgggtagtcttcgg tggctgcaggagagcgatgctgcgcctctgcccctctcctgccacctggctgcccacaga gctctccagggcagaagtcgcggtgggctcagtgggtgccctgagcggggtctctcagac tga |
Protein Sequence |
>10077 : length: 320 MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQW AFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVE DAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLDRKGKYTLTPR ACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR ALQGRSRGGLSGCPERGLSD |