|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10206 |
Name | TRIM13 |
Synonym | CAR|DLEU5|LEU5|RFP2|RNF77;tripartite motif containing 13;TRIM13;tripartite motif containing 13 |
Definition | B-cell chronic lymphocytic leukemia tumor suppressor Leu5|CLL-associated RING finger|E3 ubiquitin-protein ligase TRIM13|RING finger protein 77|leukemia-associated protein 5|putative tumor suppressor RFP2|ret finger protein 2|tripartite motif protein 13|tr |
Position | 13q14 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
potential | "A cosmid and cDNA fine physical map of a human chromosome 13q14 region frequently lost in B-cell chronic lymphocytic leukemia and identification of a new putative tumor suppressor gene, Leu5." |
potential | Human gene RFP2 is a candidate tumor suppressor located at 13q14.3 and deleted in multiple tumor types. . |
potential | Distinct organization of the candidate tumor suppressor gene RFP2 in human and mouse. |
potential | "RFP2, c13ORF1, and FAM10A4 are the most likely tumor suppressor gene candidates for B-cell chronic lymphocytic leukemia." |
| More detail of all 4 literatures about TRIM13 | |
|
External Links |
|
Links to Entrez Gene | 10206 |
Links to all GeneRIF Items | 10206 |
Links to iHOP | 10206 |
|
Sequence Information |
|
Nucleotide Sequence |
>10206 : length: 1233 atggatgtgatggagctgcttgaagaagatctcacatgccctatttgttgtagtctgttt gatgatccacgggttttgccttgctcccacaacttctgcaaaaaatgcttagaaggtatc ttagaagggagtgtgcggaattccttgtggagaccagctccattcaagtgtcctacatgc cgtaaggaaacttcagctactggaattaatagcctgcaggttaattactccctgaagggt attgtggaaaagtataacaagatcaagatctctcccaaaatgccagtatgcaaaggacac ttggggcagcctctcaacattttctgcctgactgatatgcagctgatttgtgggatctgt gctactcgtggggagcacaccaaacatgtcttctgttctattgaagatgcctatgctcag gaaagggatgcctttgagtccctcttccagagctttgagacctggcgtcggggagatgct ctttctcgcttggataccttggaaactagtaagaggaaatccctacagttactgactaaa gattcagataaagtgaaggaattttttgagaagttacaacacacactggatcaaaagaag aatgaaattctgtctgactttgagaccatgaaacttgctgttatgcaagcatatgaccca gagatcaacaaactcaacaccatcttgcaggagcaacggatggcctttaacattgctgag gctttcaaagatgtgtcagaacccattgtatttctgcaacagatgcaggagtttagagag aaaatcaaagtaatcaaggaaactcctttacctccctctaatttgcctgcaagcccttta atgaagaactttgataccagtcagtgggaagacataaaactagtcgatgtggataaactt tctttgcctcaagacactggcacattcattagcaagattccctggagcttttataagtta tttttgctaatccttctgcttggccttgtcattgtctttggtcctaccatgttcctagaa tggtcattatttgatgacctggcaacttggaaaggctgtctttcaaacttcagttcctat ctgactaaaacagccgatttcatagaacaatcagttttttactgggaacaggtgacagat gggtttttcattttcaatgaaagattcaagaattttactttggtggtactgaacaatgtg gcagaatttgtgtgcaaatataaactattataa |
Protein Sequence |
>10206 : length: 410 MDVMELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTC RKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGIC ATRGEHTKHVFCSIEDAYAQERDAFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTK DSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAE AFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKL SLPQDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGCLSNFSSY LTKTADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL |