|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10253 |
Name | SPRY2 |
Synonym | hSPRY2;sprouty homolog 2 (Drosophila);SPRY2;sprouty homolog 2 (Drosophila) |
Definition | protein sprouty homolog 2|sprouty 2|spry-2 |
Position | 13q31.1 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 6 PubMed records as below. |
|
Evidence Status |
Description |
potential | "in the context of K-rasG12D-mediated lung tumorigenesis, Sprouty-2 is also up-regulated and functions as a tumor suppressor to limit tumor number and overall tumor burden". |
reviewed | "Spry2 expression is downregulated and miRNA-21 is upregulated in the clinical samples of colon cancer, which correlates with clinical stage of disease. Thus, Spry2 functions as a tumor suppressor in colon cancer." |
reviewed | "The authors observed that Env of Jaagsiekte sheep retrovirus induced the expression of a tumor suppressor, Sprouty2, suggesting a correlation between Env-effect and Sprouty2 expression." |
potential | may function as a candidate tumor suppressor for hepatocellular carcinoma development. |
reviewed | Spry2 plays a role as tumor suppressor in NSCLC by antagonizing receptor tyrosine kinase-induced signaling at different levels. |
potential | hSPRY2 is a potential tumor suppressor locus in a prostate cancer cell line. |
| More detail of all 6 literatures about SPRY2 | |
|
Pathways and Diseases |
|
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | Signaling by EGFR;Reactome;REACT:9417 |
Pathway | Signaling events mediated by PTP1B;PID Curated;200033 |
Pathway | Internalization of ErbB1;PID Curated;200146 |
Pathway | EGF receptor signaling pathway;PANTHER;P00018 |
Pathway | EGFR downregulation;PID Reactome;500515 |
Pathway | sprouty regulation of tyrosine kinase signals;PID BioCarta;100029 |
Pathway | FGF signaling pathway;PANTHER;P00021 |
Pathway | FGF signaling pathway;PID Curated;200189 |
Disease | Type 2 diabetes;NHGRI |
Disease | Prostate cancer;FunDO |
Disease | nonsyndromic cleft lip with or without cleft palate;GAD |
Disease | Nonsyndromic cleft lip with or without cleft palate;NHGRI |
Disease | Melanoma;FunDO |
Disease | Liver cancer;FunDO |
Disease | DEVELOPMENTAL;GAD |
|
External Links |
|
Links to Entrez Gene | 10253 |
Links to all GeneRIF Items | 10253 |
Links to iHOP | 10253 |
|
Sequence Information |
|
Nucleotide Sequence |
>10253 : length: 948 atggaggccagagctcagagtggcaacgggtcgcagcccttgctgcagacgccccgtgac ggtggcagacagcgtggggagcccgaccccagagacgccctcacccagcaggtacatgtc ttgtctctggatcagatcagagccatccgaaacaccaatgagtacacagaggggcctact gtcgtcccaagacctgggctcaagcctgctcctcgcccctccactcagcacaaacacgag agactccacggtctgcctgagcaccgccagcctcctaggctccagcactcgcaggtccat tcttctgcacgagcccctctgtccagatccataagcacggtcagctcagggtcgcggagc agtacgaggacaagtaccagcagcagctcctctgaacagagactgctaggatcatccttc tcctccgggcctgttgctgatggcataatccgggtgcaacccaaatctgagctcaagcca ggtgagcttaagccactgagcaaggaagatttgggcctgcacgcctacaggtgtgaggac tgtggcaagtgcaaatgtaaggagtgcacctacccaaggcctctgccatcagactggatc tgcgacaagcagtgcctttgctcggcccagaacgtgattgactatgggacttgtgtatgc tgtgtgaaaggtctcttctatcactgttctaatgatgatgaggacaactgtgctgacaac ccatgttcttgcagccagtctcactgttgtacacgatggtcagccatgggtgtcatgtcc ctctttttgccttgtttatggtgttaccttccagccaagggttgccttaaattgtgccag gggtgttatgaccgggttaacaggcctggttgccgctgtaaaaactcaaacacagtttgc tgcaaagttcccactgtcccccctaggaactttgaaaaaccaacatag |
Protein Sequence |
>10253 : length: 315 MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPT VVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRS STRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCED CGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNCADN PCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC CKVPTVPPRNFEKPT |