|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10263 |
Name | CDK2AP2 |
Synonym | DOC-1R|p14;cyclin-dependent kinase 2 associated protein 2;CDK2AP2;cyclin-dependent kinase 2 associated protein 2 |
Definition | CDK2-associated protein 2|DOC-1-related protein|cyclin-dependent kinase 2-associated protein 2|tumor suppressor deleted in oral cancer related 1|tumor suppressor deleted in oral cancer-related 1 |
Position | 11q13 |
Gene Type | protein-coding |
Source | Count: 1; TAG |
Literature support | Count: 0 PubMed records as below. |
|
Evidence Status |
Description |
| . |
| More detail of all 0 literatures about CDK2AP2 | |
|
External Links |
|
Links to Entrez Gene | 10263 |
Links to all GeneRIF Items | 10263 |
Links to iHOP | 10263 |
|
Sequence Information |
|
Nucleotide Sequence |
>10263 : length: 381 atgtcctacaaacccatcgcccctgctcccagcagcacccctggctccagcacccctggg ccgggcaccccggtccctacaggaagcgtcccgtcgccgtcgggctcagtgccaggagcc ggcgctcctttcagaccgctgtttaacgactttggaccgccttccatgggctacgtgcag gcgatgaagccacccggcgcccagggctcccagagcacctacacggacctgctgtcagtc atagaggagatgggcaaagagatccggcctacctatgctggcagcaagagcgccatggag cgcctgaagagaggtatcatccatgcccgggccctagtcagagagtgcctggcagagaca gagcggaacgcccgcacgtaa |
Protein Sequence |
>10263 : length: 126 MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQ AMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAET ERNART |