|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1028 |
Name | CDKN1C |
Synonym | BWCR|BWS|KIP2|WBS|p57;cyclin-dependent kinase inhibitor 1C (p57, Kip2);CDKN1C;cyclin-dependent kinase inhibitor 1C (p57, Kip2) |
Definition | cyclin-dependent kinase inhibitor 1C|cyclin-dependent kinase inhibitor p57|p57Kip2 |
Position | 11p15.5 |
Gene Type | protein-coding |
Source | Count: 4; Pubmed_search,TAG,Generif,UniProt |
Literature support | Count: 5 PubMed records as below. |
|
Evidence Status |
Description |
potential | "p57KIP2, a structurally distinct member of the p21CIP1 Cdk inhibitor family, is a candidate tumor suppressor gene." |
reviewed | Imprinted CDKN1C is a tumor suppressor in rhabdoid tumor and activated by restoration of SMARCB1 and histone deacetylase inhibitors. |
reviewed | The expression of CDKN1C decreases in the large majority of breast cancers and does not appear to be mediated by AI/LOH at the gene. CDKN1C may be a breast cancer tumor suppressor. |
reviewed | Differential tumor suppressor properties and transforming growth factor-beta responsiveness of p57KIP2 in leukemia cells with aberrant p57KIP2 promoter DNA methylation. |
reviewed | Compensation by tumor suppressor genes during retinal development in mice and humans. |
| More detail of all 5 literatures about CDKN1C | |
|
Pathways and Diseases |
|
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Disease | Cancers;KEGG DISEASE |
Disease | Ovarian disease;FunDO |
Disease | Adrenal carcinoma;KEGG DISEASE;H00033 |
Disease | CARDIOVASCULAR;GAD |
Disease | Cancers of endocrine organs;KEGG DISEASE |
Disease | atherosclerosis, generalized myocardial infarct;GAD |
Disease | Congenital abnormality;FunDO |
Disease | Cancer;FunDO |
Disease | Beckwith-Wiedemann syndrome;OMIM |
Disease | Placenta disease;FunDO |
Disease | Atherosclerosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 1028 |
Links to all GeneRIF Items | 1028 |
Links to iHOP | 1028 |
|
Sequence Information |
|
Nucleotide Sequence |
>1028 : length: 951 atgtccgacgcgtccctccgcagcacatccacgatggagcgtcttgtcgcccgtgggacc ttcccagtactagtgcgcaccagcgcctgccgcagcctcttcgggccggtggaccacgag gagctgagccgcgagctgcaggcccgcctggccgagctgaacgccgaggaccagaaccgc tgggattacgacttccagcaggacatgccgctgcggggccctggacgcctgcagtggacc gaagtggacagcgactcggtgcccgcgttctaccgcgagacggtgcaggtggggcgctgc cgcctgctgctggcgccgcggcccgtcgcggtcgcggtggctgtcagcccgcccctcgag ccggccgctgagtccctcgacggcctcgaggaggcgccggagcagctgcctagtgtcccg gtcccggccccggcgtccaccccgcccccagtcccggtcctggctccagccccggccccg gctccggctccggtcgcggctccggtcgcggctccggtcgcggtcgcggtcctggccccg gccccggccccggctccggctccggctccggccccggctccagtcgcggccccggcccca gccccggccccggccccggccccggcccccgccccggccccggccccggacgcggcgcct caagagagcgccgagcagggcgcgaaccaggggcagcgcggccaggagcctctcgctgac cagctgcactcggggatttcgggacgtcccgcggccggcaccgcggccgccagcgccaac ggcgcggcgatcaagaagctgtccgggcctctgatctccgatttcttcgccaagcgcaag agatcagcgcctgagaagtcgtcgggcgatgtccccgcgccgtgtccctctccaagcgcc gcccctggcgtgggctcggtggagcagaccccgcgcaagaggctgcggtga |
Protein Sequence |
>1028 : length: 316 MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNR WDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLE PAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAP APAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLAD QLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSA APGVGSVEQTPRKRLR |